KEGG   Polaromonas sp. JS666: Bpro_0780Help
Entry
Bpro_0780         CDS       T00343                                 

Definition
(GenBank) Penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00550  Peptidoglycan biosynthesis
pol01100  Metabolic pathways
pol01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pol00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bpro_0780
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Bpro_0780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pol01003]
    Bpro_0780
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pol01011]
    Bpro_0780
Enzymes [BR:pol01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Bpro_0780
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Bpro_0780
Glycosyltransferases [BR:pol01003]
 Polysaccharide
  Bacterial polysaccharide
   Bpro_0780
Peptidoglycan biosynthesis and degradation proteins [BR:pol01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Bpro_0780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB RhodobacterPufX
Motif
Other DBs
NCBI-ProteinID: ABE42736
UniProt: Q12FF6
LinkDB All DBs
Position
complement(801194..803608)
Genome map
AA seq 804 aa AA seqDB search
MSSKPSSSNSNSHAVMQPSWQRWLIKLVLWGAGLAVAGVVGILLFVAVALSVAYPNLPDI
SDLLDYRPKLPLRVYSADGVVIGEFGEERRNLTPIKDIPQVMKDAVLAIEDARFFSHGGV
DYLGVIRAGFANVGRAKSQGASTITMQVARNVYLSAEKSYTRKIYEILLTFKLEHLLTKD
QILEIYMNQIFLGNRAYGFAAASEAYFGKPLKNISIAEAAMLAGLPKAPSAYNPIVNPKR
AKARQLYIIERMQENGFITAEQAKAAKEEELQVRVGRDNGRVHAEYVAETVRQLVHNQYG
DETYTRGLNVYTTLRAADQTVAYKALRKGIMDYERRQIYRGPEKFIDLPANPQETEDAID
DALTDNPDNGDVMSAVVLEATPKRILAMRQNSETVEITGEGLRPAQSGLADKAGPSIKIR
RGALIRVAKTPKNTWEITQLPEVEGAFVALDPRDGSIRALVGGFDFEKNKFNHVTQAWRQ
PGSSFKPFIYSAALEKGFTPATVVNDAPLFFDAGVTGGQPWEPKNYDGTFEGPMNLRTGL
KKSKNMISIRILQSVGAQYAQDWITHFGFEAEKHPAYLTMALGAGSVTPMQMATAYSVFA
NGGYRVNPYLVTKITDQRGKVLLETTPPVLDESARAIDARNAFIMDSLLQEVARSGTAAR
AQATLKRPDLFGKTGTTNDSIDTWFVGFQPTLAAAVWMGYDTPKKLGDRETGGGLSLPIW
INFMEYALKGVPVTEYPAPEGVVNVNGEWYYNEYARGSGVSSVGTQDPAAVNAGQLPAPG
TPGGPIQVLPPSDEKKRILDLFKN
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaagccctcctcttcgaactcaaactcccacgcggtgatgcagccctcctgg
caacgctggctgatcaagctggttttgtggggcgccgggctggcagtcgcgggggtggtc
ggcatccttctgtttgtagccgtcgccctgtcggtggcctaccccaacctgccggacatc
tcggatttgctggactaccggcccaagttgccgctgcgtgtgtattccgcagatggcgtg
gtgattggcgagtttggcgaagaacgccgcaacctcacgcccatcaaagacatcccccag
gtcatgaaggacgccgtgctggcgatcgaagatgcccgctttttttcgcatggcggcgtg
gactatcttggtgtgatccgcgccggctttgccaatgtgggccgtgcaaaaagccagggc
gcctccaccatcaccatgcaggtggcccgcaatgtgtacctgtctgccgaaaagagctat
acgcgcaagatttatgaaatcctgctgacgttcaagctggagcacctgctgaccaaggat
cagatcctcgaaatctacatgaaccagatttttctgggaaaccgggcctacggctttgcc
gcggcttcggaggcctactttggcaagcccctcaaaaacatctcgatcgccgaagccgcc
atgctggccggcctgcccaaagcgccctcggcgtacaacccgatcgtcaaccccaagcgc
gcgaaagcccgccagctctacatcattgagcgcatgcaggagaacggcttcatcacggca
gagcaggccaaggcagccaaagaggaagagctccaggtcagggtcgggcgcgataacggc
cgggtgcatgccgaatatgtcgctgaaaccgtacgccagctggtccataaccagtatggc
gacgaaacctatacacgcggcctcaatgtctacaccaccttgcgcgccgccgaccagaca
gtagcttacaaggccttgcgcaagggcatcatggactacgagcgccggcaaatttaccgc
ggtcctgagaagttcatcgaccttccggccaacccgcaggagacggaagatgcgattgac
gacgcactgaccgacaaccccgacaacggcgacgtgatgtcggcggtggtgctggaagcc
actcccaagcggattctcgcgatgcgccagaacagcgagacggttgaaatcaccggcgaa
gggcttcggccggcgcaatccggcctggccgacaaggcgggccccagcatcaaaattcgc
cgtggcgccctgatccgggtggccaaaacgccaaaaaacacctgggagatcacccagctg
cctgaggtcgaaggggcttttgtggcgctggacccgcgtgatggctccattcgcgcgctg
gtgggcgggtttgattttgagaagaacaagttcaaccatgtgacccaggcctggcggcaa
ccgggctccagcttcaagcccttcatctattcggctgccctggaaaaaggcttcacgccg
gccaccgtggtcaacgacgcgcccctgttttttgacgccggcgtgaccggcggccagcca
tgggagcccaagaactatgacggcaccttcgaggggcccatgaatttacggaccggcctg
aaaaaatcaaaaaacatgatttccatccgcattctgcagtcggtgggcgcgcagtatgca
caggactggatcacccacttcggctttgaagctgaaaaacatccggcgtacctgaccatg
gcactgggcgccggctccgtcacgcccatgcaaatggccacggcttattcggtgtttgcc
aatggcggctaccgcgtcaacccctacctggtgaccaagatcaccgaccagcgcggcaag
gtgctgctcgaaaccacaccgcccgtcctggatgagtccgccagggccatcgatgcccgc
aacgccttcatcatggacagcctgttgcaggaagtggcgcgctcaggcacagccgccaga
gcgcaggcgaccctcaagcgccccgacctcttcggtaaaaccggtaccaccaatgactcg
atcgatacctggttcgtcggcttccagcccaccctggcggcagccgtctggatgggttac
gacacgcccaaaaagcttggcgatcgggaaaccggcggcggcctgagcctgccgatctgg
atcaacttcatggaatacgccctgaaaggcgtgccggtcaccgaatacccggcgcccgaa
ggcgtggtgaatgtcaatggcgagtggtactacaacgagtacgccaggggctcgggggtg
agcagcgtgggaacgcaggatccggcagcggtcaacgccggccaactgcccgccccgggc
acgccgggcggcccgattcaggtcttgccaccctctgacgaaaagaaacggattctggat
ctgttcaagaactga

DBGET integrated database retrieval system