KEGG   Polaromonas sp. JS666: Bpro_1286Help
Entry
Bpro_1286         CDS       T00343                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00040  Pentose and glucuronate interconversions
pol00051  Fructose and mannose metabolism
pol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bpro_1286
   00051 Fructose and mannose metabolism
    Bpro_1286
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Bpro_1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AlaDh_PNT_C HI0933_like Pyr_redox_2 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABE43236
UniProt: Q12E06
LinkDB All DBs
Position
complement(1327840..1328880)
Genome map
AA seq 346 aa AA seqDB search
MKAAVLRAPKVLQLSDIATPEAAPGELVLRVRAAMVCGTDLRILTGRKTKGVRFPSVIGH
EFAGEVVQVGDGVTQFKTGDRVCMDPVIPCRACAYCKTGHENVCLHRQAMGYEFDGAFAE
YIRIPAIALTAGNVFMMPAQMSFESAALAEPLACCINGQRNAGVQVGDTVVVLGAGPIGL
MHAALARLSGARQVIVSEPNAARRQAAVDRGVEHMCDPSTESVMEFVKARTDGLGADVVI
LAIGVPQLANESLNLVRKGGHVNLFAGFSAGETSNIDVNLIHYNEIVVTGASALRRRDYE
LALNMLSAGQIDANSLITHRYEVADSLAAFDEAGSGRALKVAIHNV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgttctgcgcgcccccaaggtactgcaactcagcgacatcgccacaccg
gaagccgcacccggcgagctggtgctgcgtgtgcgggctgcgatggtctgcgggacggat
ctgcgaattttgactggccgaaagaccaagggggtacgttttccctcggtcatcggacac
gagtttgcgggcgaagtggttcaggtcggcgacggcgtgactcagttcaagacgggagac
cgtgtctgcatggatcccgtcatcccctgccgggcctgcgcctattgcaagaccgggcac
gaaaatgtctgccttcatcggcaggccatgggctatgaattcgacggcgcttttgccgag
tacatccgtattccggcgatcgcgctcacggcgggaaatgtgttcatgatgcccgcgcag
atgagctttgaatccgccgcactcgccgagcccctggcctgctgcatcaacggccagcgc
aatgccggtgtccaggtcggagataccgtggtggtcctcggagccggccccatcggcctg
atgcacgccgcgctggcgcgtctctcgggagccaggcaggtgattgtcagcgagcccaat
gcggcgcggcgccaggctgccgtcgaccggggcgttgaacatatgtgcgaccccagcacc
gagtctgtcatggagtttgtcaaggcccgcaccgacggactcggcgcggatgttgtgatt
ctcgccattggcgtcccgcagcttgccaatgaatcgctcaatctggtccgcaagggggga
cacgtcaacctctttgcgggtttctcggccggtgagacctcgaacatcgatgtcaacctg
atccactacaacgaaatcgtggtcacgggcgccagtgccctgaggcgacgcgactacgaa
cttgcgctgaacatgctgtcagccggtcagatcgacgccaattcgctgatcacccatcgc
tacgaggtcgcggattcgctggcagcctttgacgaagccggcagcggccgggccctgaag
gtggcgattcacaatgtctga

DBGET integrated database retrieval system