KEGG   Polaromonas sp. JS666: Bpro_2255Help
Entry
Bpro_2255         CDS       T00343                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein, PhoT family
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
pol  Polaromonas sp. JS666
Pathway
pol02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pol00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bpro_2255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pol02000]
    Bpro_2255
Enzymes [BR:pol01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Bpro_2255
Transporters [BR:pol02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Bpro_2255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_15 AAA_23 AAA_29 RsgA_GTPase AAA_16 Rad17 TniB AAA_30 AAA_25 G-alpha AAA_33 AAA_28 AAA Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: ABE44180
UniProt: Q12BB2
LinkDB All DBs
Position
2342099..2342890
Genome map
AA seq 263 aa AA seqDB search
MDTLTASREKLAEKSKISVKNLDFFYGKFHALKSINLEIPEKKVTAFIGPSGCGKSTLLR
IFNRMYELYPEQRAEGDVTFDGENLLTSKKDVALIRSKVGMVFQKPTPFPMSIYDNIAFG
VKLFESLNASDMDERVEWALRKAALWGEVKDKLNQSGSSLSGGQQQRLCIARGIAIKPEV
LLLDEPCSALDPISTAKVEELIAELKNDYTVVIVTHNMQQAARCSDYTAYMYLGDLVEFG
ATEDLFFKPKRKETEDYITGRFG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggataccctcactgcgtcacgcgaaaagctggccgagaaatcgaaaatatcggtcaaa
aacctcgacttcttctacggaaaatttcacgccctcaaaagcattaatctggaaattccc
gagaaaaaagtcacagccttcattggcccctcgggctgcggaaaatccaccctgctgcgg
atcttcaaccgcatgtatgaactttatcccgagcagcgtgcggagggggacgttacgttt
gacggggaaaacctgctgacctccaaaaaggacgtggcgctgatccgctccaaggtcggc
atggtctttcagaagcccacgccatttcccatgtcgatttatgacaatattgcttttggg
gtcaagctgtttgaaagcctcaacgcctcggatatggacgagcgggtcgagtgggcactg
cgcaaggcggctctctggggggaagtcaaggacaagctgaaccagagcggttccagcctg
tccggaggccagcagcaacggttgtgcattgcccgcggcattgccatcaagcccgaggtg
ttgctgctcgatgagccttgctcggcgctggaccccatttccacggccaaggtggaggaa
ctgattgccgagctgaaaaacgactacacggtggtgatcgtcacgcacaacatgcagcag
gccgcccgctgcagcgattacacggcctatatgtacctgggcgatcttgttgaatttggt
gccacggaagacctcttcttcaaacccaagcgcaaagagacggaagactacatcaccggc
cgtttcggatga

DBGET integrated database retrieval system