KEGG   Polaromonas sp. JS666: Bpro_3003Help
Entry
Bpro_3003         CDS       T00343                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD polymerase module / ATP-dependent DNA ligase LigD phosphoesterase module
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pol  Polaromonas sp. JS666
Pathway
pol03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pol00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Bpro_3003
Enzymes [BR:pol01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Bpro_3003
DNA repair and recombination proteins [BR:pol03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Bpro_3003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABE44917
UniProt: Q128X5
LinkDB All DBs
Position
3164060..3166708
Genome map
AA seq 882 aa AA seqDB search
MGSADLLKTYRARRDFKQTPEPATGGERSGKALRFVVQKHAARSLHYDFRLELQGTLKSW
AVPKGPSLDPAVKRMAVHVEDHPMAYAGFEGTIPPGQYGAGHVIVWDRGLWTPVGNPAAG
LKNGKLKFELHGEKLKGGWTLVRMHGHAGESHEPWLLIKEQDDHARPEQVFDVLQALPNS
VLSGKPLPGKAATGTQCAPRAARTRKAAPESHAGKHARTTAASARSGKSIPKGIPEGAVK
SRLPGTLAPELATLVNRVPADPQDWIYEIKFDGYRLLTRTEGDSVRCITRNGNDWTARLP
GLAKAVAQLDIRSAWLDGEIVVMNDQGVPSFGALQNAFDSASTADIRYYVFDLPFYDGLD
LRQVPLAQRREILRTALTRNPQDSIRFSEAFDQPPQDLIDSAQRLGLEGVIGKRAASPYV
SRRSPDWIKLKTRLRQEFVIGGYTEPKGSRTGLGALLLGVHDAQGRLRYAGNVGTGFNAE
TLRSLKERLSTLHSERSPFAALPTGVKGQWVKPQLLAEVAFGEWTHGGHIRHPVFQGLRT
DKPARNILRETPTSPVTPRKGSDMPQDAATPGPTSRKTRDKAPGKAPESVRITHPDRVID
KTTGFTKQAMVEHYAAVAPLMLPHLKGRPVALVRAPAGVGGELFFQKHAQATAIPGIKLL
DPALDPGHEPLLEIPSAAALLEAAQVNVVEFHTWNATSRAIRKPDRMTFDLDPGEKVGWP
EMQEAAQLVHSLLDELGLASFLKTSGGKGLHVVVPLRRSHDFDTVKDFSHAIVKHLAGVL
PQRFVAKSGPKNRVGRIFVDYLRNGFGATTVSAWSARARPGLGVSVPVAWDELASLTGGA
HWTATTIGGRLATGNQPWKDYGARANGLAEAMKKLGFKPPAH
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgggttccgcggatttgctgaaaacctaccgcgccaggcgcgacttcaagcagacgccc
gagcccgccacgggaggcgagcgctccggcaaggcgttgaggtttgtggtccagaagcat
gcggcgcgcagcctgcactacgacttccggctggaactgcagggcacgctgaaaagctgg
gcggttcccaaggggccgagcctggatccggccgtcaaacgcatggccgtgcatgtcgaa
gaccacccgatggcctatgcaggctttgaaggcaccattccacccgggcagtacggtgcc
ggccacgtcattgtgtgggaccgcgggctctggacgccggtgggcaacccggccgcaggc
ctgaagaacggcaagctcaaatttgaactgcatggtgaaaagctcaagggaggctggacg
ctggtgcgcatgcacggccatgccggggaaagccatgaaccctggctgctgatcaaggag
caggacgaccacgcacgccccgagcaggtatttgatgtactccaggcgctgcccaacagc
gtgctttccggcaagcccttgcctggcaaggcagccaccggcacacagtgcgcccctcgc
gctgcgcgcaccagaaaagcagcgcctgaaagccacgccgggaagcacgccagaacaacg
gcggccagcgcacggtccggtaaaagcattcccaaaggcattcccgaaggcgcggtgaaa
tccaggctgcccggcacgctggccccggaactggccacgctggtcaaccgcgtgcctgcc
gacccgcaagactggatctacgaaatcaagtttgatggctaccggctgctcacccgcacc
gagggagactcggtgcgctgcatcacgcgcaacggcaacgactggaccgccaggctgcct
gggctggccaaagccgttgcacaactggatatacgctccgcctggctggacggcgaaatc
gtggtgatgaatgaccagggcgtgcccagcttcggcgcgctgcaaaacgcctttgacagc
gccagcacggccgacatccgctactacgtgttcgacctgccgttttacgatgggctggac
ctgcgccaggtgccgctggcgcagcggcgtgaaatcctgcgcacggccctgacgcgcaat
ccgcaggacagcatccgtttcagcgaggcgtttgaccagcccccgcaagacctgatcgac
tcggcccagcgcctgggcctggaaggcgtgatcggcaagcgcgcagcctcgccctacgtc
tcgcgccgctcgcccgactggatcaagctcaaaacccggctgcgccaggagtttgtgatt
ggcggctacaccgagcccaaaggctcccgcaccggcctgggagccctgctgctgggtgtg
catgatgcgcagggcaggctccggtacgccggcaacgtgggcacaggcttcaatgccgag
acactgcgcagcctcaaggagcggctgtcaacgctgcacagcgagcgcagcccgtttgcc
gcgctgccgacaggcgtcaaagggcaatgggtgaagccgcaactgctggccgaagtggcg
tttggcgaatggacccacggcggccacattcgacaccccgtgttccagggacttcgcacc
gacaaaccggccagaaacatcctccgtgagacgcccacatcaccagtcaccccccggaaa
ggctccgacatgccgcaagacgctgccacaccaggccccaccagccgcaaaacccgtgac
aaggcccctggcaaggctcctgagtccgtgcgcatcacgcatcccgaccgcgtgattgac
aagaccaccggcttcaccaagcaagccatggtggagcactacgccgccgtcgccccgctc
atgctgccgcacctcaaggggcgcccggttgccctggtccgcgcgccggcaggcgtcggg
ggtgagctgtttttccagaaacacgcgcaagccacggcgattcccggcatcaagctgctc
gacccggcgctggacccgggacatgagccgctgctcgagatcccttctgcagcggccctg
ctggaagccgcgcaagtcaatgtcgtggaattccacacctggaacgcgaccagccgcgcc
attcgcaagcctgaccgcatgaccttcgacctggaccccggcgaaaaggttggctggccg
gagatgcaggaggccgcgcagctggtgcactctcttctggatgagctgggactggccagt
tttctgaaaaccagcggaggcaagggcctgcacgtcgtggtgccgctgaggcgcagccac
gacttcgacacggtgaaggatttctcgcacgccattgtgaagcacttggcaggtgtcttg
ccgcaacgcttcgtggcgaagagcggccccaaaaaccgggtcggcaggatatttgtggac
tacctgcgcaacggtttcggcgccacgaccgtctcggcctggtcggcgcgcgcgcggcca
gggctgggggtctcggtaccggtggcgtgggatgaactggcttccctgaccggaggtgcg
cactggaccgcgacgacgataggcgggcggctggcgactggaaaccagccctggaaggac
tatggcgcccgcgccaatggcctggcggaggcgatgaaaaagctgggcttcaagccgccc
gcccattga

DBGET integrated database retrieval system