KEGG   Polaromonas sp. JS666: Bpro_3007Help
Entry
Bpro_3007         CDS       T00343                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bpro_3007
Enzymes [BR:pol01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bpro_3007
Transporters [BR:pol02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bpro_3007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2 DUF1490
Motif
Other DBs
NCBI-ProteinID: ABE44921
UniProt: Q128X1
LinkDB All DBs
Position
complement(3168430..3169164)
Genome map
AA seq 244 aa AA seqDB search
MPYELHYWPTIQGRGEFVRLALEAAGADYVDVARGLEGEKAGQGMAAMMHVMESPEVQRP
PFAPPFLVHGKVIVGQTAAILLYLGPRLGLVGKSEVQRVWTHQLQLTIADVVAEAHDTHH
PIATGLYYQDQKPEAARRAKEFRQTRMPKFLAWFESVLARNPRGSRHLVGGRLSYADLSL
FQLVEGLQYAFPKASRRALKKVPNVAALHASVAQHRRVAPYLASERRIAFNEDGIFRRYP
ELDA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgaacttcattactggccaacgattcaggggcgcggcgaatttgtgcgcctg
gcgctggaggccgcaggcgccgactatgtggatgtggcgcgcgggcttgaaggcgaaaaa
gccgggcagggcatggcggccatgatgcatgtcatggaaagccccgaggtgcagcgtccg
ccgtttgcaccccccttcctggtgcacggcaaggtcatcgtcgggcagacggcggccatc
ctgctgtacctgggccctcgcctcgggctggtcggcaagagcgaggttcagcgcgtgtgg
acgcaccagctgcagctgacgattgccgacgtcgtcgccgaggcgcacgacacacaccac
ccgattgccaccggcctctactaccaggatcagaagccggaagcggcccggcgcgcaaag
gagtttcgccagacgcgcatgcccaaattcctggcctggtttgaaagcgtgctggcgcgc
aacccccggggcagtcgccatctggtgggtgggcggttgagctacgcggacctgtcgctt
ttccagctggtggaaggcctgcaatacgcttttcccaaggccagccggcgcgcgttgaaa
aaggtgccgaacgtggccgccttgcatgccagcgtggcccagcatcgccgcgtggcgccc
tacctggccagcgagcgacgcatagccttcaatgaagacggcatctttcgccgttacccg
gaacttgacgcctga

DBGET integrated database retrieval system