KEGG   Polaromonas sp. JS666: Bpro_3045Help
Entry
Bpro_3045         CDS       T00343                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pol  Polaromonas sp. JS666
Brite
KEGG Orthology (KO) [BR:pol00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bpro_3045
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bpro_3045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_oxidored GIDA Glutaredoxin FAD_binding_2 DAO FAD_binding_3 HI0933_like AlaDh_PNT_C Thi4 K_oxygenase FMO-like Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABE44959
UniProt: Q128T3
LinkDB All DBs
Position
3210626..3212197
Genome map
AA seq 523 aa AA seqDB search
MLDASTKAQLKSYLERATQPIEIIASLDDGKASGELLSLLKDVAESSPLVTLTESRDDPH
RKPSFSVNRPGENHGPRFAGLPMGHEFTSLILALLQVGGYPPRVEQAVLEQIRALDGDFE
FEIYVSLTCHNCPDVVQALNLMAVQNPRIRTTMIEGGTFQDEVKERQVMAVPTVFLNGTE
FGQGRMSLEEILAKIDTSGVEHEAAKIAAKDPFDVLIVGGGPAGAAAAVYAARKGIRTGV
ASERFGGQVLDTMGIENFISIKETEGPKFAHALEEHVRNYDVDIMNLQRAKALVPNTGPG
KDLIEIQLESGASLKSRSIVISTGARWRNINVPGEREYKNKGVAYCPHCDGPLFKGKRVA
VIGGGNSGVEAAIDLAGIVGHVTLIEFDTALRADAVLQRKLTSLKNVTVFTHAQTTEITG
DQKVNGLIYKERASGELKKVELEGVFIQIGLVPNTDWLKGVVELSRHGEIVVDAKGQTSV
PGVFAAGDVTTVPFKQIIIAAGEGAKAALSAFDHLIRTSAPAA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccagcaccaaagcccaactgaagagttacctcgagcgcgccacgcagccg
atcgaaatcatcgcgtcgctcgacgacggcaaggcctcgggcgagctgctgtcgctgctc
aaggatgtggctgaatcgtcgccgctggtcacgctgaccgaaagccgcgacgacccgcac
cgcaagccctcgttctcggtcaaccgcccgggcgaaaaccacggcccgcgttttgccggc
ctgcccatgggccatgaattcacctcgctgatcctggcgctgctgcaggtcggcggctac
ccgccgagagtcgagcaggccgtgttggagcagattcgtgcgctcgacggggattttgaa
tttgagatttatgtttcacttacctgccacaactgccccgacgtggtccaggcgctgaac
ctgatggcggtgcagaacccgcgtatccgcaccaccatgatcgaaggcggcaccttccag
gacgaggtcaaggagcgccaggtcatggccgtgcccaccgtctttttgaacggcaccgag
ttcggccagggccgcatgagcctggaagaaatcctggcaaaaatcgacaccagcggtgtg
gaacacgaagcggccaaaatcgccgccaaggacccgttcgacgtgctgatcgtcggcggc
ggcccggccggtgccgcagcggcggtgtacgccgcgcgcaaaggcatacgcaccggcgtg
gcgtcggagcgtttcggcggccaggtgctggacaccatgggcatcgagaatttcatctcg
atcaaggaaaccgaggggccgaaattcgcgcacgcgctggaagaacacgtgcgcaactat
gacgtcgacatcatgaacctgcagcgcgccaaggcgctggttccgaataccggaccaggc
aaggacctgatcgagatccagcttgaaagcggtgcctcgctcaaaagcaggtcgatcgtc
atatcgaccggcgcgcgctggcgcaacatcaacgtgccgggcgagcgcgagtacaaaaac
aagggcgtggcctactgcccgcactgcgacggcccgttgttcaagggcaagcgcgtggcg
gtgataggcggcggcaactccggtgtcgaagcggcgatcgatctggccggcatcgtcggg
catgtgacgctgatcgagttcgacactgcgctgcgtgccgatgccgtgctgcagcgcaag
ctcaccagcctgaagaacgtgaccgtgttcacccatgcgcagaccaccgagatcaccggt
gaccagaaggtcaatggcctcatctacaaggagcgtgcaagcggcgagttgaagaaggtc
gaactggaaggcgtgttcatccagatcggcctggtacccaacaccgactggctcaagggc
gtggttgagttgtcccggcatggcgagatcgtggtggatgccaagggccagacctctgtg
cctggcgtatttgcagccggcgatgtgacgaccgtgcctttcaagcagatcatcatcgcg
gcaggcgaaggcgcaaaggccgcgctgagcgctttcgatcacctgatccgcacttcagca
ccggcagcctga

DBGET integrated database retrieval system