KEGG   Polaromonas sp. JS666: Bpro_3554Help
Entry
Bpro_3554         CDS       T00343                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pol  Polaromonas sp. JS666
Brite
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Bpro_3554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5 CHRD AARP2CN
Motif
Other DBs
NCBI-ProteinID: ABE45462
UniProt: Q126T0
LinkDB All DBs
Position
3754230..3754745
Genome map
AA seq 171 aa AA seqDB search
MKSRLTLLASALVLTACASMTSGPRAVAQLQSTTGNTATGTVSFTKSGDKVVVKGEVRGL
KPNAEHGFHVHEKGDCSSGDGLSAGGHFNPDGKPHGNHSDMAHHAGDLPSLKADASGVAK
FSFETTSIAVGSGPSDVTGRGLIVHRDPDDYKTQPTGNAGPRLACAVIARG
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcccgtttgacactgcttgccagcgcccttgttctgacagcctgcgcctccatg
accagcggcccgcgcgccgtggcccagctccaaagtaccacgggcaacaccgccaccggc
accgtcagctttaccaagagcggggacaaggtggtcgtgaagggtgaagtgcgcggcctc
aagcccaacgccgagcacggctttcacgtgcatgaaaaaggcgactgctccagtggcgac
ggcttgagcgcgggcggccatttcaaccccgatggcaagccccatggaaatcattccgac
atggctcaccatgccggcgatttgcccagcctgaaagccgatgccagcggcgtcgcgaaa
ttcagctttgaaaccacctccatcgccgtcggcagcggccccagcgacgtgacgggccgc
gggctgattgttcaccgtgacccggacgattacaagacccaacccaccggcaacgccggc
ccacggctggcttgcgctgtgatcgcgcggggctga

DBGET integrated database retrieval system