KEGG   Polaribacter sp. BM10: BXQ17_00335Help
Entry
BXQ17_00335       CDS       T04746                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pola  Polaribacter sp. BM10
Pathway
pola00010  Glycolysis / Gluconeogenesis
pola00020  Citrate cycle (TCA cycle)
pola00620  Pyruvate metabolism
pola01100  Metabolic pathways
pola01110  Biosynthesis of secondary metabolites
pola01120  Microbial metabolism in diverse environments
pola01130  Biosynthesis of antibiotics
pola01200  Carbon metabolism
Module
pola_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BXQ17_00335
   00020 Citrate cycle (TCA cycle)
    BXQ17_00335
   00620 Pyruvate metabolism
    BXQ17_00335
Enzymes [BR:pola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BXQ17_00335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AQS92606
UniProt: A0A1U9L3F0
LinkDB All DBs
Position
complement(70533..72191)
Genome map
AA seq 552 aa AA seqDB search
MATVINMPRLSDTMEEGVVAKWLKNVGDKIEEGDILAEIETDKATMEFESFYEGTLLHIG
IQEGETSPVDVLLAVIGEEGEDISDILNGNSSNDKASESNKEEKSKEPKTEKSEENTSSS
SVAIPEGVQVITMPRLSDTMTDGTVATWLKNVGDAVEEGDMLAEIETDKATMEFECFYEG
TILYIGVQEGETAPVDSLLTIIGPEGTDVSAIVENGGAVSSSNDAETKEQETKKETSKEE
SKPEDSKSTETTNNNSTNSNGGRIFASPLAKKIASDKGINLADVKGSGENGRIIKKDVEN
YTPAAKTEEKASATNTQAATTVAAGVENSREVKNSQMRKAIAKSLGNSKFTSPDFSLNIE
VSMDNAMASRKTINAIPDTKVSFNDMVVKACAMALKKHPQVNTSWSDANTIYHDHIHVGV
AVAVADGLLVPVIRHTDQLSLTQIGAGVRDLAGKARNKKITPAEMQGSTFTVSNLGMFGI
DNFTSIINQPNSAILSVGAIVEKPVVKDGQIVVGNTMKLTLTCDHRTVDGAVGAQFLQTL
KTYIENPVTMLA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctacagtaataaacatgccccgattaagtgacaccatggaagaaggtgttgtggca
aaatggttaaaaaatgttggagataaaattgaggaaggagacattttagccgaaattgaa
acagacaaagctacaatggagtttgagtcgttttatgaaggaacattattacatattggt
attcaagaaggtgaaacttctccagttgatgtattgttagctgttatcggtgaagaaggt
gaagatatttctgatattttaaatggaaattcttctaacgataaagcttctgaatctaat
aaggaagaaaaatccaaagaaccaaaaacagaaaaatctgaagaaaatacttctagtagt
tctgttgctattcctgaaggagtgcaggtaattactatgcctcgtttaagtgatacaatg
acagatggtactgtagcaacttggttaaaaaacgttggtgacgcagttgaagagggtgat
atgcttgcagaaattgaaactgacaaagcaacaatggaatttgaatgtttctacgaagga
actattctttacattggtgtgcaagaaggtgaaactgcaccagttgatagtttgttaact
attattggaccagaaggtacagatgtttctgcaattgtagaaaacggaggtgctgtttct
agttcaaatgatgcagaaactaaagagcaagaaactaaaaaagagactagcaaagaagaa
agtaaacctgaggattctaaatctacagaaacgactaacaacaattctacaaattctaat
ggtggtagaatttttgcttcacctttggctaaaaaaatagcttctgataagggcatcaat
ttagcagacgtaaaaggttctggtgaaaatggtagaattataaaaaaggatgttgaaaat
tacacgcctgctgctaaaactgaagaaaaagcatctgcaactaatacacaagcagcaact
acagttgcagcaggtgtagagaactctagagaagttaaaaactctcaaatgagaaaagca
attgctaagtctttaggtaattctaaatttacttctccagactttagtctaaatattgaa
gtaagtatggataatgcaatggcttcaagaaaaacaattaatgcaataccagatacgaaa
gtatcttttaatgacatggttgttaaagcttgcgctatggcattaaagaaacatccacaa
gtaaatacatcttggtcagatgcaaatacaatttatcatgatcatattcatgttggtgtt
gctgttgctgttgcagacggattacttgtacctgtaataagacacacagatcaattaagt
ttaactcaaattggtgctggtgttagagatttagcaggtaaagcaagaaataaaaagatt
actcctgcagaaatgcaaggaagtacttttactgtttctaacttaggtatgtttggtatt
gataattttacatcaataattaaccaaccaaactctgcaattttatctgttggtgcaatt
gttgaaaaaccagttgtaaaagacggacaaatagtagttggtaatacaatgaagttaacg
ttaacttgtgaccacagaactgttgatggtgctgttggtgctcagtttttacaaacttta
aaaacatatatagaaaaccctgttacaatgttagcttag

DBGET integrated database retrieval system