KEGG   Polaribacter sp. BM10: BXQ17_05945Help
Entry
BXQ17_05945       CDS       T04746                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pola  Polaribacter sp. BM10
Pathway
pola00473  D-Alanine metabolism
pola00550  Peptidoglycan biosynthesis
pola01100  Metabolic pathways
pola01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pola00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BXQ17_05945
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BXQ17_05945
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BXQ17_05945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pola01011]
    BXQ17_05945
Enzymes [BR:pola01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BXQ17_05945
Peptidoglycan biosynthesis and degradation proteins [BR:pola01011]
 Precursor biosynthesis
  Amino acid ligase
   BXQ17_05945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AQS93624
UniProt: A0A1U9L6D3
LinkDB All DBs
Position
1320050..1321027
Genome map
AA seq 325 aa AA seqDB search
MKQNIAIVMGGYSSEVHISLKSGNVVYNHLNKDKYNVYRVLILKEKWVVLDHNDKEYPIE
KNDFSFTYNNAKVTFNCVFNAIHGAPGENGQLLAYFNLINIKHTSAPFYQMALTFNKRDT
LSAVKAYGIQTATSIYINKGDIIDIDAIVKKVGLPCFIKPNNAGSSYGISKAHTKEAILP
AIETAFKEDSEILIESFLDGTEVSVGVIQFQGKVKVLPITEIVSENDFFDYEAKYEGKSQ
EITPARISSIQEAKVIAVAKKVYTILNMRGFSRSEYIFVNDEPYFLEMNTVPGLTEESIL
PQQAQAAGITLAALFDNAITTALNN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaatattgccatagtaatgggtggttattcatctgaagttcacatttcttta
aaaagcggaaatgtagtttataaccatctaaataaagacaagtacaatgtctatagagtc
cttattttaaaagaaaaatgggttgtattagatcataatgacaaagaatatccaatagaa
aaaaacgatttttcttttacttataacaatgcaaaagttacttttaattgtgtttttaat
gccatacatggtgctcccggagaaaacggacaactgttagcgtatttcaaccttatcaat
ataaagcacacctctgccccattttatcaaatggctttaacttttaataaaagagatacg
ttaagtgcggtaaaagcttatggtattcaaacagcaacatctatttacatcaataaaggc
gacattatagatatcgacgctattgtaaaaaaagttggtttgccttgttttatcaaacca
aacaacgccggttctagctacggtatttctaaagcgcatacaaaagaggcaattttacct
gccatagaaactgcttttaaagaagattcagaaattttaatcgagtcttttttagatggt
acagaagtttctgttggtgttattcaattccaaggtaaagttaaagtgttaccaattaca
gagattgtttctgaaaacgattttttcgattatgaagcaaagtacgaaggcaagtcgcaa
gagattacgccggcaagaatttcttctatacaagaagcaaaagtaatagcagttgccaaa
aaagtatataccattttaaacatgcgtggtttttctagatctgaatacatttttgtaaac
gacgaaccttactttttagaaatgaatactgtaccaggattaacagaagaaagcatatta
ccacaacaagcacaagctgcaggcattactttagctgcattatttgacaatgccataact
actgctttaaataactaa

DBGET integrated database retrieval system