KEGG   Polaribacter sp. BM10: BXQ17_13140Help
Entry
BXQ17_13140       CDS       T04746                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pola  Polaribacter sp. BM10
Pathway
pola00620  Pyruvate metabolism
pola00680  Methane metabolism
pola01100  Metabolic pathways
pola01120  Microbial metabolism in diverse environments
pola01200  Carbon metabolism
Module
pola_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BXQ17_13140
  09102 Energy metabolism
   00680 Methane metabolism
    BXQ17_13140
Enzymes [BR:pola01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BXQ17_13140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4378 ECH_1 PCI
Motif
Other DBs
NCBI-ProteinID: AQS94969
UniProt: A0A1U9LAD5
LinkDB All DBs
Position
complement(3010548..3013127)
Genome map
AA seq 859 aa AA seqDB search
MSGLPKLARFNENVLSKYQIYNSIFMTLPFDTINNTGVLLPLFNELCKKGFQEGKNPTEI
VDAFFSKYQENPSEKEKTDLLFRFIQYIERQVVLFDAIEDAAFPVVNNMDGVGTLRNSKE
TAILGEKKEALKAYLEEFKVRVVLTAHPTQFYPGSVLGIITDLDKAIQNDDLLLIKKLLA
QLGKTPFYKKSKPTPFDEAVSLIWYLENVFYHSVSKIYNYIQNNIYDGNPMDNEIIDLGF
WPGGDRDGNPFVTTQITLDVAERLRQSVLRSYYRDVRKLKRRFTFDGVQEILTKIEKRLY
KHVVRSYSKVNFSQGILLQELAEARKIVETKHQSLFIEELDDFINKVRIFGFHFATLDIR
QDSRVHHKAFTQIVKDLQETGDTTFPKNYEHLPEDEQIEILSVVKGSIDPKSLSDETSVS
TIESIYALKEIQKRNGERGANRYIISNNQTALNVMETFAMLNLCGFENELPVDVIPLFET
VEDLQNAEEVMRKLYSNRTYRYHLEKRKNKQTIMLGFSDGTKDGGYLMANWGIFKAKEAL
TKVSREFDIEVIFFDGRGGPPARGGGKTHQFYASLGPTIEDKEIQLTIQGQTISSNFGTE
NSAQYNLEQLLSSGIKNDIFTKDQLNEKNRELIEDMAATSYQTYVDFKNHAQFLPYLEKM
STLKYYAKTNIGSRPSKRGGSDKLDFSALRAIPFVGSWSQLKQNVPGFFGVGTALKKYED
ADRFDEVIAFYNESDFFKTLLENSMMSLTKSFFELTAYMANDKEFGDFWKLIYEEYKTTK
RLLLKLTGHKDLMENFPVGKASIEIREQIVLPLLTIQQFALKQIQELQNSDGNSEKLKIY
EKMVMRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggattacctaagctagctcgttttaacgaaaacgtattgtctaaatatcaaatt
tacaacagtatttttatgactttgccattcgacaccataaataataccggtgttctattg
ccattgtttaatgagttatgtaaaaaaggttttcaagaaggtaaaaatcctacagaaatt
gtagatgctttttttagcaaataccaagaaaatccttcagaaaaagaaaaaacagattta
ttatttcgttttatacaatatatagaaagacaagttgtattgtttgatgctatagaagac
gccgcttttcctgttgttaataatatggatggagtgggtacgctaagaaactctaaagaa
actgccattttaggtgaaaagaaagaagctttaaaagcttatttagaagaatttaaagtt
cgagttgttttaactgcgcatccaacacaattttacccaggttctgttttaggtattatt
acagatttagacaaagcaattcaaaatgatgacttgcttttaattaaaaaacttttagca
caattaggtaaaacgcctttttataaaaaatcgaaaccaacaccttttgatgaagctgta
agtttaatttggtatttagaaaatgtcttttaccattctgtaagtaaaatatacaactac
attcaaaacaatatctatgacggaaatccgatggataacgaaattatagatcttggtttt
tggcctggtggtgatagagatggtaacccatttgtaacaacccaaataactttagacgtt
gcagaaaggttaagacaatctgttttaagaagttattatagagatgttagaaaacttaaa
agacgttttacctttgatggcgttcaagagattttaactaagatcgagaaaagactttac
aaacacgttgtaagaagttatagcaaagtaaacttttctcaaggcatattattacaagaa
cttgcagaggcaagaaaaattgtagaaacaaaacatcaatctttatttatagaagaatta
gatgattttattaataaagttagaatttttggtttccattttgcaactttagatattaga
caagacagtagagtgcatcataaagcttttactcaaattgttaaagatttacaagaaact
ggcgatactacttttcctaaaaactacgaacatttaccagaagatgaacaaatagaaatt
ttatctgttgttaaaggaagcatcgatccaaaatctttaagcgatgaaacttctgtaagt
acaatagaatctatttatgctttaaaagaaattcaaaaaagaaacggagaaagaggtgca
aaccgttacattataagtaacaatcaaaccgcactaaatgttatggaaacatttgcaatg
cttaacctttgtggctttgaaaacgaattacctgtagatgttataccgctttttgaaaca
gtagaagatttacaaaatgcagaagaagtaatgcgtaaattgtatagtaatagaacgtat
agatatcatttagaaaagagaaaaaacaaacaaactataatgttaggtttttctgatgga
actaaagatggtggatatttaatggcaaattggggaatttttaaagcaaaagaagcatta
acaaaagtttctagagaatttgatattgaagtaatattctttgacggacgtggaggacct
cctgctcgtggtggaggaaaaacacaccaattttacgcatctttaggaccaacaatagaa
gataaagaaattcaactcacaatacaaggtcaaacgattagttctaattttggtacagaa
aattctgcacaatacaacttagagcaattattaagttctggtattaaaaatgatattttt
acaaaagatcagttaaacgaaaaaaatagagaattaattgaagacatggcagctaccagc
taccaaacttatgtcgactttaaaaatcatgcgcagtttttaccgtatttagaaaaaatg
agtacgttaaaatactatgctaaaactaacattggtagtagacctagtaaacgtggtggc
tcagataaattagacttctctgctcttagagcaattccttttgttggaagctggagccag
ttaaaacaaaacgtaccaggattttttggagtaggaactgctttaaagaaatatgaagat
gcagatagatttgatgaagtaattgcattttacaatgaatctgacttctttaaaaccttg
ctagaaaacagtatgatgagtttaacaaaatcatttttcgaattaacagcatacatggct
aacgataaagaatttggtgatttctggaaacttatttacgaagaatacaaaacaactaaa
aggctacttttaaaacttactggtcacaaagatttaatggaaaactttccagtaggaaaa
gcctctatagaaattagagaacagattgttttaccacttcttacaattcagcaatttgct
ttaaaacaaattcaagaacttcaaaattctgatggaaactcagaaaaattaaaaatatat
gagaaaatggtgatgcgttctttattcggaaatattaacgcaagtcgaaactctgcataa

DBGET integrated database retrieval system