KEGG   Polaribacter sp. BM10: BXQ17_13285Help
Entry
BXQ17_13285       CDS       T04746                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pola  Polaribacter sp. BM10
Pathway
pola00240  Pyrimidine metabolism
pola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pola00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BXQ17_13285
Enzymes [BR:pola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BXQ17_13285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AQS94994
UniProt: A0A1U9LA92
LinkDB All DBs
Position
complement(3041069..3041704)
Genome map
AA seq 211 aa AA seqDB search
MFLENTVNHTEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQRVEIFKPAVDTRYDDEE
VVSHNDNRIRSTPVPASANIRLLANNVDVVGIDEAQFFDDEIVAVCNDLANRGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTHTGNLAHYSFRKAKNDNIVMLGETQEYEP
LSRAAYYKALQKQQQEVLSATEKDSATKDSD
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacagtaaatcatacagaacaatttggttggatagaagtaatatgc
ggctctatgttttctggtaaaacagaagaacttattagacgtttaaaacgtgcacagttt
gcaaaacagcgtgtagaaatttttaaaccagctgtagatactcgttatgacgatgaagaa
gttgtatcgcataacgataatagaattagatctacacccgtacctgcatctgcaaatatt
agacttttagccaacaatgtagatgttgttggtatagatgaagcacagttttttgatgat
gaaattgttgcggtttgtaacgatttagcaaatagaggaattcgtgtaattgttgctggt
ttagatatggattttaaaggaaatcctttcggaccaatgcctgctttaatggcaactgca
gaatacgtaaccaaagtgcatgcagtctgtacgcatacaggtaatttagcgcattacagt
tttagaaaggctaaaaacgacaacattgtaatgttaggtgaaacgcaagaatatgaacct
ttaagtagagcggcttattacaaagcattacaaaagcaacaacaagaagttttatctgct
acagaaaaagattctgctacaaaagattctgactaa

DBGET integrated database retrieval system