KEGG   Polaribacter sp. MED152: MED152_06030Help
Entry
MED152_06030      CDS       T02533                                 

Definition
(GenBank) Cys/Met metabolism PLP-dependent enzyme
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
pom  Polaribacter sp. MED152
Pathway
pom00270  Cysteine and methionine metabolism
pom00450  Selenocompound metabolism
pom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MED152_06030
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MED152_06030
Enzymes [BR:pom01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     MED152_06030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Met_gamma_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: EAQ42254
UniProt: A2TZX0
LinkDB All DBs
Position
complement(1361140..1362339)
Genome map
AA seq 399 aa AA seqDB search
MSYNPADKIQDLQYFGEFGGVNPSISDSSTYTFLSAKTMFDTFEGNADGCYLYSRHSTPS
NLYLGEALAAMEGTETANVTASGMGAITPVLLQLCGANDHIISSRTIYGGTYAFLKNFTP
KLGIDTTFVDITKLDVVEAAITKNTKVLYCESVSNPLLEVADIKGLSGLAKKYNLKLVVD
NTFSPLSISPVKLGADIVIHSLTKFINGSSDTVGGVVCGTQEFINDLRNVNDGACMLLGS
TMDSLRASSILKNMRTLHIRMKQHSKNAHYLAEKFQDDGLKTVYPGLASHSSHDLFKTMM
NKEYGFGGMLTIDVGSLEKANTLMELMQERNLGYLAVSLGFYKTLFSAPGSSTSSEIPED
EQKEMGLSDGLIRFSIGLDNNIERTYEMMKNCMKEVGVL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagctataatccagcagataagatacaagatttacaatattttggagaatttggaggt
gtaaatccttctatttcagattcatctacttacacttttttatcagcaaagactatgttc
gatacttttgaaggtaatgcagatggctgttatttatactcacgtcattcaacaccatct
aatttatatttgggtgaagctttagcggctatggaaggtacagaaacagcaaatgttact
gcttcaggaatgggtgcaattacacctgttttattacaattgtgtggcgcaaatgatcat
attatttctagtagaactatttatggaggtacttatgcatttctaaaaaactttactccg
aaattaggcattgatactactttcgtagatattacaaagctagatgttgtagaggctgca
atcactaaaaacaccaaagttttgtattgcgaatctgtaagtaatccgctgcttgaggtt
gcagatattaaaggattgtcaggtttagctaaaaaatacaatttaaaattggtggtagat
aatacattttctccattatcaatttcaccagtaaaattaggcgcagatattgtaatacat
agtttaacaaaattcattaatggctcttcagatactgttggtggtgtagtttgtggtacg
caagaatttattaatgatttacgaaatgtaaacgatggcgcttgtatgttattaggttct
actatggatagtttgcgagcttcttctatattaaaaaatatgagaactcttcatattaga
atgaaacaacatagtaaaaacgctcactatttagcagaaaagtttcaagatgatggttta
aaaacggtgtatcctggtttagcatcacattcttcacatgacttatttaaaacaatgatg
aacaaagaatatggttttggaggtatgctaactattgatgttggatcattagaaaaagca
aatactttaatggagttaatgcaagaaagaaaccttgggtatttggcagtaagtcttggt
ttttacaaaacgttattttcagctccaggtagttctacatcttcagaaatacctgaagat
gagcaaaaagaaatggggctttcagatggtttaattcgtttttcaattggtttagataat
aacattgaacgtacttatgaaatgatgaaaaattgtatgaaagaagtgggtgttttgtaa

DBGET integrated database retrieval system