KEGG   Polaribacter sp. MED152: MED152_09950Help
Entry
MED152_09950      CDS       T02533                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pom  Polaribacter sp. MED152
Pathway
pom00620  Pyruvate metabolism
pom00680  Methane metabolism
pom01100  Metabolic pathways
pom01120  Microbial metabolism in diverse environments
pom01200  Carbon metabolism
Module
pom_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MED152_09950 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    MED152_09950 (ppc)
Enzymes [BR:pom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MED152_09950 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4378
Motif
Other DBs
NCBI-ProteinID: EAQ43038
UniProt: A2TXN6
LinkDB All DBs
Position
complement(2223990..2226569)
Genome map
AA seq 859 aa AA seqDB search
MSTLPKLTKFNDNVLSKYQIYNSIFITLPFDTINNTGVLLPLFHKVCEKGFKNGKNPTEL
VEKFFKKYQDTPSEKDKKDLLFQFIQYIERQVVLFDAIEDAAFPVVNNMDGFGTLRNSKE
SATLSGKDEALKKYLEDFKVRVVLTAHPTQFYPGSVLGIITDLDKAIQNDDLLLIKKLLA
QLGKTPFYKKSKPTPFDEAVSLIWYLENVFYHSVSKIHNYIQEHVYDGQPTENEIIDLGF
WPGGDRDGNPFVTTQITLDVAERLRQSILRNYYRDVRRLKRRFTFDGVQEILSRVEKRLY
KHVVRSYAKVNFSKEILLEELENAREIVIKNHDSLFIDELNDVINKVRIFGFHFATLDIR
QDSRVHHKAFTQIVDDLLASGDTTFPKNYQRLSPEEQVEVLALVKGNIDPSIFSDEMSVK
TIESIYALKTIQQRNGESGANRYIISNNQTALNVMQTFAMLNLCGFENELPVDVIPLFET
VDDLENASDVMRTLYSNKAYRYHLSKRKDKQTIMLGFSDGTKDGGYLMANWGIFKAKEAL
TKVSREFDIEVIFFDGRGGPPARGGGKTHQFYASLGPTIEDKEIQLTIQGQTISSNFGTL
DSSQFNLEQLISSGIKNEVFTKDQINDTNREIINDLANTSYKTYVDFKNHPQFLSYLEKM
STLKYYAKTNIGSRPSKRSNSDTLDFSALRAIPFVGSWSQLKQNVPGFFGVGTALKKYED
ADRFDEIVAFYNASDFFKTLLENSMMSLTKSFFGLTAYMADDPVYGEFWKLIYEEYKTTK
RLLLKLTGHKELMENYPEGKASIAMRESIVLPLLTIQQFALKKIQDLQQSEGNEAEIEVY
EKMVMRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccttaccaaaacttaccaaattcaatgacaatgtcttgtctaagtatcaaatt
tataatagtatttttattacgctaccttttgatacgataaacaacactggtgtattgcta
cctctatttcataaagtatgtgaaaaaggttttaaaaacggaaaaaatcctacagaactt
gtagaaaaattctttaaaaaatatcaagatacaccatcagaaaaagacaagaaagattta
ctctttcaattcattcaatacatagaacgtcaagtagttttattcgatgcgatagaagat
gctgcttttcctgtggtaaataatatggatggttttggaacacttagaaactctaaagaa
tctgctacattaagtggtaaagatgaagctttaaaaaagtatttagaagattttaaagta
cgtgtagttttaactgctcatcctactcaattttacccaggttcagttttgggtatcatt
acagatttagataaagccatacaaaatgatgatttacttttaataaaaaagctattagct
caattaggtaaaacaccattttataaaaaatctaaaccaacaccttttgatgaagctgta
agcttaatttggtatttagaaaacgtattttatcattcagtaagtaaaattcacaactat
attcaagagcatgtttacgatgggcaacctacagaaaatgaaattatagatttagggttt
tggcctggaggagatagagatggtaacccatttgtaactactcaaattactttagatgtt
gcagaaagattgcgtcaatcaatcttaagaaactattacagagatgtaagacgtttaaaa
agacgttttacttttgatggtgtacaagaaatactatctagagtagaaaagcgcttatac
aaacatgttgttagaagttatgctaaagtaaatttctctaaagaaatacttttagaagag
ctagaaaacgctagagaaattgtcattaaaaatcatgattcgttatttatagatgaactt
aatgatgtaattaataaagtaagaatttttggttttcactttgcaacattagacattagg
caagatagtagagtgcatcataaagcgtttactcaaattgttgatgatttattggcaagt
ggagatactactttcccaaaaaattatcaaagattatcaccagaagaacaagtagaagtt
ttagccttggtaaaaggcaatattgatccttctatcttttcagatgaaatgtctgtaaaa
actatagaatctatttatgccttaaagaccatacaacaaagaaatggtgaaagtggtgca
aatagatatattattagtaacaaccaaactgcattaaacgtaatgcaaacctttgcgatg
ctaaacttatgtggttttgagaatgaattacctgtagatgtaattccgctttttgaaact
gtagacgatttagaaaacgcaagcgatgttatgagaacgctttattctaataaagcctac
agatatcacttatctaaaagaaaagacaaacaaactattatgttaggcttctctgatgga
actaaagatggtggttatttaatggcaaattggggaattttcaaagcaaaagaagcacta
acaaaagtatctagagagtttgatatagaggttattttctttgatggtagaggtggacca
ccagcaagaggtggaggaaaaacgcatcaattctatgcatctttaggccctactatagag
gataaagaaatacaattaactattcaaggtcaaaccattagttctaactttggtacttta
gattcttcacaatttaatttagaacaattaataagttctggtattaaaaatgaggttttt
actaaagaccaaattaacgataccaatagagaaattattaatgacttggctaatacaagt
tataaaacgtatgtagatttcaaaaatcatccacaatttttatcgtatttagaaaaaatg
agtaccttaaaatattacgcgaaaacaaatattggtagtaggccaagtaaaagatctaac
tcagatactttagatttttctgctttaagagctataccttttgtaggtagttggagtcaa
ttaaaacaaaatgttccaggattttttggtgtaggaactgcactaaaaaaatatgaagat
gcagatcgatttgacgaaattgtagctttctataatgcttcagatttctttaaaacttta
ctagaaaatagtatgatgagtttaaccaaatctttctttggtttaacagcatatatggct
gatgatcctgtttatggggaattctggaaattaatttatgaggagtataaaacaacaaaa
agattgttactaaaacttacaggtcataaagaattaatggagaattatcctgaaggtaaa
gcttctatagcaatgagagagagcattgttttaccattattaaccatacagcaatttgcg
ttaaagaaaattcaagatttacaacaatctgaaggtaatgaagcagagattgaagtctat
gaaaaaatggtaatgcgttctttatttggtaatattaacgctagtagaaattcagcatag

DBGET integrated database retrieval system