KEGG   Pongo abelii (Sumatran orangutan): 100137030
Entry
100137030         CDS       T01416                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor precursor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04520  Adherens junction
pon05100  Bacterial invasion of epithelial cells
pon05144  Malaria
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
pon05218  Melanoma
pon05223  Non-small cell lung cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100137030 (MET)
   04014 Ras signaling pathway
    100137030 (MET)
   04015 Rap1 signaling pathway
    100137030 (MET)
   04020 Calcium signaling pathway
    100137030 (MET)
   04151 PI3K-Akt signaling pathway
    100137030 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100137030 (MET)
   04520 Adherens junction
    100137030 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100137030 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100137030 (MET)
   05202 Transcriptional misregulation in cancer
    100137030 (MET)
   05206 MicroRNAs in cancer
    100137030 (MET)
   05205 Proteoglycans in cancer
    100137030 (MET)
   05230 Central carbon metabolism in cancer
    100137030 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100137030 (MET)
   05226 Gastric cancer
    100137030 (MET)
   05218 Melanoma
    100137030 (MET)
   05211 Renal cell carcinoma
    100137030 (MET)
   05223 Non-small cell lung cancer
    100137030 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100137030 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    100137030 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100137030 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100137030 (MET)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100137030 (MET)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  MET family
   100137030 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 100137030
NCBI-ProteinID: NP_001162038
Ensembl: ENSPPYG00000017932
UniProt: Q2IBD8 A0A2J8UPG2
LinkDB
Position
7
AA seq 1390 aa
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETLIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHPLNQNGYTLVVTGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECSSGTWTQQICLPAIYKVFPSSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNILKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
GISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISIALLLLLGFFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
TRPASFWETS
NT seq 4173 nt   +upstreamnt  +downstreamnt
atgaaggcccccgctgtgcttgcacctggcatcctcgtgctcctgtttaccttggtgcag
aggagcaatggggagtgtaaagaggcactagcaaagtccgagatgaatgtgaatatgaag
tatcagcttcccaacttcaccgcggaaacactcatccagaatgtcattctacatgagcat
cacattttccttggtgccactaactacatttatgttttaaatgaggaagaccttcagaag
gttgctgagtacaagaccgggcctgtgttggaacacccagattgtttcccatgtcaggac
tgcagcagcaaagccaatttatcaggaggcgtttggaaagataacatcaacatggctcta
gttgtcgacacctactatgatgatcaactcattagctgtggcagcgtcaacagagggacc
tgccagcgacatgtctttccccacaatcatactgctgacatacagtcggaggttcactgc
atattctccccacagatagaagagcccagccagtgtcctgactgtgtggtgagcgccctg
ggagccaaagtcctttcatctgtaaaggaccggttcatcaacttctttgtaggtaatacc
ataaattcttcttatttcccagatcatccattgcattcaatatcagtgagaaggctaaag
gaaacgaaagatggttttatgtttttgacggaccagtcctacattgatgttttacctgag
ttcagagattcttaccccattaagtatgtccatgcctttgaaagcaacaattttatttac
ttcttgacggtccaaagggaaactctagatgctcagacttttcacacaagaataatcagg
ttctgttccataaactctggattgcattcctacatggaaatgcctctggagtgtattctt
acagaaaagagaaaaaagagatccacaaagaaggaagtgtttaatatccttcaggctgcg
tatgtcagcaagcctggggcccaacttgctagacaaataggagccagcctgaatgatgac
attctctttggggtgttcgcacaaagcaagccagattctgccgaaccaatggatcgatct
gccatgtgtgcattccctatcaaatatgtcaacgacttcttcaacaagatcgtcaacaaa
aacaatgtgagatgtctccagcatttttacggacccaatcatgagcactgttttaatagg
acacttctgagaaattcatcaggctgtgaagcgcgccgtgatgaatatcgaacagagttt
accacagctttgcagcgcgttgacttattcatgggtcaattcagcgaagtcctcttaaca
tctatatccaccttcattaaaggagacctcaccatagctaatcttgggacatcagagggt
cgcttcatgcaggttgtggtttctcgatcaggaccatcaacccctcatgtgaattttctc
ctggactcccatccggtgtctccagaagtgattgtggagcatccattaaaccagaatggc
tacacactggttgtcactgggaagaagatcacgaagatcccattgaatggcttgggctgc
agacatttccagtcctgcagtcagtgcctctctgccccaccctttgttcagtgtggctgg
tgccatgacaaatgtgtgcgatcggaggaatgctcgagcgggacatggactcaacagatc
tgtctgcctgcaatctacaaggttttcccaagtagtgcaccccttgaaggagggacaagg
ctgaccatatgtggctgggactttggatttcggaggaataataaatttgatttaaagaaa
actagagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgatgaat
atattgaaatgcacagttggtcctgccatgaataagcatttcaatatgtccataattatt
tcaaatggccacgggacaacacaatacagtacattctcctatgtggatcctgtaataaca
ggtatttcgccgaaatatggtcctatggctggtggcactttacttactttaactggaaat
tacctaaacagtgggaattccagacacatttcaattggtggaaaaacatgtactttaaaa
agtgtgtcaaacagtattcttgaatgttataccccagcccaaaccatttcaactgagttt
gctgttaaattgaaaattgacttagccaaccgagagacaagcatcttcagttaccgggaa
gatcccattgtctacgaaattcatccaaccaaatcttttattagtggtgggagcacaata
acaggtgttgggaaaaacctgaattcagttagtgtcccgaggatggtcataaatgtgcat
gaagcaggaaggaactttactgtggcatgtcaacatcgctctaattcagagataatctgc
tgtaccactccttccctgcaacagctgaatctgcaactccccctgaaaaccaaagccttt
ttcatgttagatgggatcctttccaaatactttgatctcatttatgtacataatcctgtg
tttaagccttttgaaaagccagtgatgatctcaatgggcaatgaaaatgtactggaaatt
aagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaataag
agctgtgagaatatacacttacattctgaagccgttttatgcacggtccccaatgacctg
ctgaaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaaccgtcctt
ggaaaagtaatagttcaaccagatcagaatttcacaggattgattgctggtgttgtctca
atatcaatagcactgttattactacttgggtttttcctgtggctgaaaaagagaaagcaa
attaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaatct
gtagactaccgagctacttttccagaagatcagtttcctaattcatctcagaacggttca
tgccgacaagtgcagtatcctctgacagacatgtcccccatcctaactagtggggactct
gatatatccagtccattactgcaaaatactgtccacattgacctcagtgccctaaatcca
gagctggtccaggcagtgcaacatgtagtgattgggcccagtagcctgattgtgcatttc
aatgaagtcataggaagagggcattttggttgtgtatatcatgggactttgttggacaat
gatggcaagaaaattcactgtgctgtgaaatccttgaatagaatcactgacataggagaa
gtttcccaatttctgaccgagggaatcatcatgaaagattttagtcatcccaatgtcctc
tcgctcctgggaatctgcctgcgaagtgaagggtctccactggtggtcctaccatacatg
aaacatggagatcttcgaaatttcattcgaaatgagactcataatccaactgtaaaagat
cttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcacagtcaaggtt
gctgattttggtcttgccagagacatgtatgataaagaatactatagtgtacacaacaaa
acaggtgcaaagctgccagtgaagtggatggctttggaaagtctgcaaactcaaaagttt
accaccaagtcagatgtgtggtcctttggcgtgctcctctgggagctgatgacaagagga
gccccaccttatcctgacgtgaacacctttgatataactgtttacttgttgcaagggaga
aggctcctacaacccgaatactgcccagaccccttatatgaagtaatgctaaaatgctgg
caccctaaagccgaaatgcgcccatccttttctgaactggtgtcccggatatcagcgatc
ttctctactttcattggggagcactatgtccatgtgaacgctacttatgtgaacgtaaaa
tgtgtcgctccatatccttctctgttgtcatcagaagataacgctgatgatgaggtggac
acacgaccagcctccttctgggagacatcatag

KEGG   Pongo abelii (Sumatran orangutan): 100171540
Entry
100171540         CDS       T01416                                 

Gene name
FGFR2
Definition
(RefSeq) fibroblast growth factor receptor 2
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05215  Prostate cancer
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100171540 (FGFR2)
   04014 Ras signaling pathway
    100171540 (FGFR2)
   04015 Rap1 signaling pathway
    100171540 (FGFR2)
   04020 Calcium signaling pathway
    100171540 (FGFR2)
   04151 PI3K-Akt signaling pathway
    100171540 (FGFR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100171540 (FGFR2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100171540 (FGFR2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100171540 (FGFR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100171540 (FGFR2)
   05230 Central carbon metabolism in cancer
    100171540 (FGFR2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100171540 (FGFR2)
   05215 Prostate cancer
    100171540 (FGFR2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100171540 (FGFR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100171540 (FGFR2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100171540 (FGFR2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100171540 (FGFR2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100171540 (FGFR2)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100171540 (FGFR2)
CD molecules [BR:pon04090]
 Proteins
  100171540 (FGFR2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100171540 (FGFR2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Kinase-like Pkinase_fungal DUF1615
Other DBs
NCBI-GeneID: 100171540
NCBI-ProteinID: NP_001124693
UniProt: Q5RF81
LinkDB
Position
10
AA seq 384 aa
MNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVM
AEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQD
GPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYL
ASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFD
RVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMR
DCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSV
FSPDPMPYEPCLPQYPHINGSVKT
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaactccaataccccgctggtgaggataacaacacgcctctcttcaacggcagacacc
cccatgctggcaggggtctccgagtatgaacttccagaggacccaaaatgggagtttcca
agagataagctgacactgggcaagcccctgggagaaggttgctttgggcaagtggtcatg
gcggaagcagtgggaattgacaaagacaagcccaaggaggcggtcaccgtggccgtgaag
atgttgaaagatgatgccacagagaaagacctttctgatctggtgtcagagatggagatg
atgaagatgattgggaaacacaagaatatcataaatcttcttggagcctgcacacaggat
gggcctctctatgtcatagttgagtatgcctctaaaggcaacctccgagaatacctccga
gcccggaggccacccgggatggagtactcctatgacattaaccgtgttcctgaggagcag
atgaccttcaaggacttggtgtcatgcacctaccagctggccagaggcatggaatacttg
gcttcccaaaaatgtattcatcgagatttagcagccagaaatgttttggtaacagaaaac
aatgtgatgaaaatagcagactttggacttgccagagatatcaacaatatagactattac
aaaaagaccaccaatgggcgacttccagtcaagtggatggctccagaagccctgtttgat
agagtatacactcatcagagtgatgtctggtccttcggggtgttaatgtgggagatcttc
actttagggggctcgccctacccagggattcccgtggaggaactttttaagctgctgaag
gaaggacacagaatggataaaccagccaactgcaccaacgaactgtacatgatgatgagg
gactgttggcatgcagtgccctcccagagaccaacgttcaagcagttggtagaagacttg
gatcgaattctcactctcacaaccaatgaggaatacttggacctcagccaacctctcgaa
cagtattcacctagttaccctgacacaagaagttcttgttcttcaggagatgattctgtt
ttttctccagaccccatgccttacgaaccatgccttcctcagtatccacacataaacggc
agtgttaaaacatga

KEGG   Pongo abelii (Sumatran orangutan): 100172156
Entry
100172156         CDS       T01416                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04114  Oocyte meiosis
pon04140  Autophagy - animal
pon04144  Endocytosis
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04510  Focal adhesion
pon04520  Adherens junction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04730  Long-term depression
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172156 (IGF1R)
   04014 Ras signaling pathway
    100172156 (IGF1R)
   04015 Rap1 signaling pathway
    100172156 (IGF1R)
   04066 HIF-1 signaling pathway
    100172156 (IGF1R)
   04068 FoxO signaling pathway
    100172156 (IGF1R)
   04151 PI3K-Akt signaling pathway
    100172156 (IGF1R)
   04152 AMPK signaling pathway
    100172156 (IGF1R)
   04150 mTOR signaling pathway
    100172156 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100172156 (IGF1R)
   04140 Autophagy - animal
    100172156 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100172156 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100172156 (IGF1R)
   04520 Adherens junction
    100172156 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    100172156 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100172156 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    100172156 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    100172156 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    100172156 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    100172156 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172156 (IGF1R)
   05202 Transcriptional misregulation in cancer
    100172156 (IGF1R)
   05205 Proteoglycans in cancer
    100172156 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100172156 (IGF1R)
   05214 Glioma
    100172156 (IGF1R)
   05218 Melanoma
    100172156 (IGF1R)
   05215 Prostate cancer
    100172156 (IGF1R)
   05224 Breast cancer
    100172156 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100172156 (IGF1R)
   01522 Endocrine resistance
    100172156 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100172156 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100172156 (IGF1R)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100172156 (IGF1R)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100172156 (IGF1R)
CD molecules [BR:pon04090]
 Proteins
  100172156 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Recep_L_domain fn3 Furin-like Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 100172156
NCBI-ProteinID: NP_001125259
Ensembl: ENSPPYG00000006808
UniProt: Q5RCL1
LinkDB
Position
15
AA seq 1064 aa
MQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLIN
IRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSFYVL
DNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNG
ERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDA
CGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILY
IRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYC
SKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFE
NFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVD
NKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFVRTMPAEGADDIPGPVTWEPR
PENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTA
RIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRN
NSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVK
DEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMT
RGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMV
AEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLW
EIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRLAFLEII
SSIKDEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGH
KAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgcaggagtgcccctcgggcttcatccgcaacggcagccagagcatgtactgcatccca
tgtgaaggtccttgccccaaggtctgtgaggaagaaaagaaaacaaagaccattgattct
gttacttctgctcagatgctccaaggatgcaccatcttcaagggcaatttgctcattaac
atccgacgggggaataacattgcttcagaactggagaacttcatggggctcatcgaggtg
gtgacgggctacgtgaagatccgccattctcatgccttggtctccttgtccttcctaaaa
aaccttcgcctcatcttaggagaggagcagctagaagggaattactccttctacgtcctc
gacaaccagaacttgcagcaactatgggactgggaccaccgcaacctgaccatcaaagca
gggaaaatgtactttgctttcaatcccaaattatgtgtttctgaaatttaccgcatggag
gaagtgacggggactaaaggacgccaaagcaaaggggacataaacaccaggaacaacggg
gagagagcctcctgtgaaagtgatgtcctgcatttcacctccaccaccacgtcgaagaat
cgcatcatcataacctggcaccggtaccggccccctgactacagggatctcatcagcttc
accgtttactacaaggaagcaccctttaagaatgtcacggagtatgatgggcaggacgcc
tgcggctccaacagctggaacatggtggacgtggacctcccacccaacaaggacgtggag
cccggcatcttactgcatgggctgaagccctggactcagtacgccgtttacgtcaaggct
gtgaccctcaccatggtggagaacgaccatatccgtggagccaagagtgagatcttgtac
attcgcaccaatgcttcagttccttccattcccttggacgttctttcagcatcgaactcc
tcttctcagttaatcgtgaagtggaaccctccctctctgcccaacggcaacctgagttac
tacattgtgcgctggcagcggcagcctcaggacggctacctttaccggcacaattactgc
tccaaagacaaaatccccatcaggaagtatgccgacggcaccatcgacattgaggaagtc
acagagaaccccaagactgaggtgtgtggtggtgagaaagggccttgctgcgcctgcccc
aaaactgaagccgagaagcaggctgagaaggaggaggctgagtaccgcaaagtctttgag
aatttcctgcacaactccatcttcgtgcccagacctgaaaggaagcggagagatgtcatg
caagtggccaacaccaccatgtccagccgaagcaggaacaccacggccgcagacacgtac
aacatcaccgacccagaagagctggagacagagtaccctttctttgagagcagagtggat
aacaaggagagaactgtcatttctaaccttcggcctttcacattgtaccgcatcgatatc
cacagctgcaatcatgaggctgagaagctgggctgcagcgcctccaacttcgtctttgta
aggactatgcccgcagaaggagcagatgacattcctgggccagtgacctgggagccaagg
cctgaaaactccatctttttaaagtggccagaacctgagaatcccaatggattgattcta
atgtatgaaataaaatacggatcacaagttgaggatcagcgagaatgtgtgtccagacag
gaatacaggaagtatggaggggccaagctaaaccggctaaacccggggaactacacagcc
cggattcaggccacatctctctctgggaatgggtcgtggacagatcctgtgttcttctat
gtccaggccaaaacaggatatgaaaacttcatccatctgatcatcgctctgcccgtcgct
gtcctgttgattgtgggagggttggtgattatgctgtacgtcttccatagaaagagaaat
aacagcaggctggggaatggagtgctgtatgcctctgtgaacccggagtacttcagcgct
gcggatgtgtacgttcctgatgagtgggaggtggctcgggagaagatcaccatgagccgg
gaacttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggtgtggtgaaa
gatgaacctgaaaccagagtggccattaaaacagtgaacgaggccgcaagcatgcgtgaa
aggatcgagtttctcaacgaagcttctgtgatgaaggagttcaattgtcaccatgtggtg
cgattgctgggtgtggtgtcccaaggccagccaacactggtcatcatggaactgatgaca
cggggcgatctcaaaagttatctccggtctctgaggccagaaatggagaataatccagtc
ctagcacctccaagcctaagcaagatgattcagatggccggagagattgcagacggcatg
gcatacctcaacgccaacaagttcgtccacagagaccttgctgcccggaattgcatggta
gccgaagatttcacagtcaaaatcggagattttggtatgacgcgagatatctatgagaca
gactattaccggaaaggagggaaagggctgctgcccgtgcgctggatgtctcccgagtcc
ctcaaggatggagtcttcaccacttactcggacgtctggtccttcggggtcgtcctctgg
gagattgccacactggccgagcagccctaccagggcttgtccaacgagcaagtccttcgc
ttcgtcatggagggcggccttctggacaagccagacaactgtcctgacatgctgtttgaa
ctgatgcgcatgtgctggcagtataaccccaagatgaggcttgccttcctggagatcatc
agcagcatcaaagacgagatggagcctggcttccgggaggtctccttctactacagcgag
gagaacaagctgcccgagccggaggaactggacctcgagccagagaacatggagagcgtc
cccctggacccctcggcctcctcgtcctccctgccactgcccgacagacactcaggacac
aaggccgagaacggccccggccctggagtactggtcctccgcgccagcttcgacgagaga
cagccttacgcacacatgaacgggggccgcaagaacgagcgggccttgccactgccccag
tcttcgacctgctga

KEGG   Pongo abelii (Sumatran orangutan): 100174302
Entry
100174302         CDS       T01416                                 

Gene name
TEK
Definition
(RefSeq) angiopoietin-1 receptor precursor
  KO
K05121  endothelial-specific receptor tyrosine kinase [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100174302 (TEK)
   04014 Ras signaling pathway
    100174302 (TEK)
   04015 Rap1 signaling pathway
    100174302 (TEK)
   04066 HIF-1 signaling pathway
    100174302 (TEK)
   04151 PI3K-Akt signaling pathway
    100174302 (TEK)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100174302 (TEK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100174302 (TEK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100174302 (TEK)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100174302 (TEK)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  TIE family
   100174302 (TEK)
CD molecules [BR:pon04090]
 Proteins
  100174302 (TEK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_Tie2_1 Pkinase fn3 Pur_ac_phosph_N fn3_2 hEGF EGF_2 APH DUF2369 DUF4702 Pkinase_fungal
Other DBs
NCBI-GeneID: 100174302
NCBI-ProteinID: NP_001127247
UniProt: Q5RDI5
LinkDB
Position
9
AA seq 1123 aa
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQ
QASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGACHEDTGEC
ICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGRKGLQCNE
ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIE
VNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKK
LLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLLRRGEGGEGHPGPVRRFTTAS
IGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWT
ILDGYSISSITIRYKVQGKNEDQHIDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGS
SNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRR
MAQAFQNREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKA
RIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVPCKLGHHPNIINLLGACEHRGYLYLA
IEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFI
HRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDV
WSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYE
RPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
NT seq 3372 nt   +upstreamnt  +downstreamnt
atggactctttagccagcttagttctctgtggagtcagcttgctcctttctggaactgtg
gaaggtgccatggacttgatcttgatcaattccctacctcttgtgtctgatgctgaaaca
tctctcacctgcattgcctctgggtggcgcccccatgagcccatcaccataggaagggac
tttgaagccttaatgaaccagcaccaggatccgctggaagttactcaagatgtgaccaga
gaatgggctaaaaaagttgtttggaagagagaaaaggccagtaagatcaatggtgcttat
ttctgtgaagggcgagttcgaggagaggcaatcaggatacgaaccatgaagatgcgtcaa
caagcttccttcctaccagctactttaactatgactgtggacaagggagataatgtgaac
atatctttcaaaaaggtattgattaaagaagaagatgcagtgatttacaaaaatggttcc
ttcatccattcagtgccccggcatgaagtaccggatattctagaagtacacctgcctcat
gctcagccccaggatgctggagtgtactcggccaggtatataggaggaaacctcttcacc
tcggccttcaccaggctgatagtccggagatgtgaagctcagaagtggggacctgaatgc
aaccatctctgtactgcttgtatgaacaatggtgcctgccatgaagatactggagaatgc
atttgccctcctgggtttatgggaaggacatgtgagaaggcttgtgaactgcacacattt
ggcagaacttgtaaagaaaggtgcagtggacaagagggatgcaagtcttatgtgttctgt
ctccctgacccctatgggtgttcctgtgccacaggccggaagggtctgcagtgcaatgaa
gcatgccaccctggtttttatgggccagattgtaagcttaggtgcagctgcaacaacggg
gagatgtgtgatcgcttccaaggatgtctctgctctccaggatggcagggactccagtgt
gagagagaaggcataccaaggatgaccccaaagatagtggatttgccagatcatatagaa
gtaaacagtggtaaatttaatcccatttgcaaagcttctggctggccgctacctactaat
gaagaaatgaccctggtgaagccggatgggacagtgctccatccaaaagactttaaccat
acggatcatttctcagtagccatattcaccatccaccggatcctcccccctgactcagga
gtttgggtctgcagtgtgaacacagtggctgggatggtggaaaagcccttcaacatttct
gttaaagttcttccaaagcccctgaatgccccaaacgtcattgacactggacataacttc
gctgtcatcaacatcagctctgagccttactttggggatggaccaatcaaatccaagaag
cttctatacaaacccgttaatcactatgaggcttggcaacatattcaagtgacgaatgag
attgttacactcaactatttggaacctcggaccgaatatgaactctgtgtgcaactgctc
cgtcgtggagagggtggggaagggcatcctggacctgtgagacgcttcacaacagcttct
atcggactccctcctccaagaggtctaaatctcctgcctaaaagtcagaccactctaaat
ttgacctggcaaccaatatttccaagctcagaagatgacttttatgttgaagtggagaga
aggtctgtgcaaaaaagtgatcagcagaatattaaagttccaggcaacttgacttcagtg
ctacttaacaacttacatcccagggaacagtacgtggtccgagctagagtcaacaccaag
gcccagggggaatggagtgaagatcttactgcttggacccttagtgacattcttcctcct
caaccagaaaacatcaagatttccaacatcacacactcctcggctgtgatttcttggaca
atattggatggctattctatttcttctattactatccgttacaaggttcaaggcaagaat
gaagaccagcacattgatgtgaagataaagaatgccaccatcactcagtatcagctcaag
ggcctagagcctgaaacagcataccaggtggacatttttgcagagaacaacatagggtca
agcaacccagccttttctcatgaactggtgaccctcccagaatctcaagcaccagcggac
ctcggaggggggaagatgctgcttatagccatccttggctctgctggaatgacctgcctg
actgtgctgttggcctttctgatcatattgcaattgaagagggcaaatgtgcaaaggaga
atggcccaagccttccaaaacagggaagaaccagctgtgcagttcaactcaggaactctg
gccctaaacaggaaggtcaaaaacaacccagatcctacaatttatccagtgcttgactgg
aatgatatcaaatttcaagatgtgattggggagggcaattttggccaagttcttaaggcg
cgcatcaagaaggatgggttacggatggatgctgccatcaaaagaatgaaagaatatgcc
tccaaagatgatcacagggattttgcaggagaactggaagttccttgtaaacttggacac
catccaaacatcatcaacctcttaggagcatgtgaacatcgaggctacttgtacctggcc
attgagtacgcgccccatggaaaccttctggactttctgcgcaagagccgtgtgctggag
acggacccagcatttgccattgccaatagcactgcgtccacactgtcctcccagcagctc
ctccacttcgctgccgacgtggcccggggcatggactacttgagccaaaaacagtttatc
cacagggatctggctgccagaaacattttagttggtgaaaactatgtggcaaaaatagca
gattttggattgtcccgaggtcaagaggtgtatgtgaaaaagacaatgggaaggctccca
gtgcgctggatggccatcgagtcactgaattacagtgtgtacacaaccaacagtgatgta
tggtcctatggtgtgttactatgggagattgttagcttaggaggcacaccctactgcggg
atgacttgtgcagaactctacgagaagctgccccagggctacagactggagaagcccctg
aactgcgatgatgaggtgtatgatctaatgagacaatgctggcgggagaagccttatgag
aggccatcatttgcccagatattggtgtccttaaacagaatgttagaggagcgaaagacc
tacgtgaataccacgctttatgagaagtttacttatgcaggaattgactgttctgctgaa
gaagcggcctag

KEGG   Pongo abelii (Sumatran orangutan): 100174431
Entry
100174431         CDS       T01416                                 

Gene name
ERBB3
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-3 precursor
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100174431 (ERBB3)
   04012 ErbB signaling pathway
    100174431 (ERBB3)
   04020 Calcium signaling pathway
    100174431 (ERBB3)
   04151 PI3K-Akt signaling pathway
    100174431 (ERBB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100174431 (ERBB3)
   05205 Proteoglycans in cancer
    100174431 (ERBB3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100174431 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100174431 (ERBB3)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100174431 (ERBB3)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100174431 (ERBB3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like
Other DBs
NCBI-GeneID: 100174431
NCBI-ProteinID: NP_001127366
Ensembl: ENSPPYG00000004643
UniProt: Q5RB22
LinkDB
Position
12
AA seq 1342 aa
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
KSCPPCHEVCKGRCWGSGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFQTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG
GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELKKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEED
NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESTVSGSNEQCPR
PVSLYPMPRGCLASESSEGHVTHSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLL
TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPNAGTTPDEDY
EYMNRQRGGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD
SAFDNPDYWHSRLFPKANAQRT
NT seq 4029 nt   +upstreamnt  +downstreamnt
atgagggcgaacgacgctctgcaggtgctgggcttgcttttcagcctggcccggggctcc
gaggtgggcaactctcaggcagtgtgtcctgggactctgaatggcctgagtgtgaccggc
gatgctgagaaccaataccagacactgtacaagctctacgagaggtgtgaggtggtgatg
gggaacctcgagattgtgctcacgggacacaatgccgacctctccttcctgcagtggatt
cgagaagtgacaggctatgtcctcgtggccatgaatgaattctctactctaccattgccc
aacctccgcgtggtgcgagggacccaggtctacgatgggaagtttgccatctttgtcatg
ttgaactataacaccaactccagccacgctctgcgccagctccgcttgactcagctcacc
gagattctgtcagggggtgtttatattgagaagaacgataagctttgtcacatggacaca
attgactggagggacatcgtgagggaccgagacgctgagatagtggtgaaggacaatggc
aaaagctgtcccccctgtcatgaggtttgcaaggggcgatgctggggttctggaccagaa
gactgccagacattgaccaagaccatctgtgctccacagtgtaatggtcactgctttggg
cccaaccccaaccagtgctgccatgatgagtgtgccgggggctgctcaggccctcaggac
acagactgctttgcctgccggcacttcaatgacagtggagcctgtgtacctcgctgtcca
cagcctcttgtctacaacaagctaactttccagctggaacccaatccccacaccaagtat
cagtatggaggagtttgtgtagccagctgtccccataactttgtggtggatcaaacatcc
tgtgtcagggcctgtcctcctgacaagatggaagtagataaaaatgggctcaagatgtgt
gagccttgtgggggactatgtcccaaagcctgtgaggggacaggctctgggagccgcttc
cagactgtggactcgagcaacattgatggatttgtgaactgcaccaagatcctgggcaac
ctggactttctgatcaccggcctcaatggagacccctggcacaagatccctgccctggac
ccagagaagctcaatgtcttccagacagtacgggagatcacaggttacctgaacatccag
tcctggccgccccacatgcacaacttcagtgttttttccaacttgacaaccattggaggc
agaagcctctacaaccggggcttctcattgttgatcatgaagaacttgaatgtcacatct
ctgggcttccgatccctgaaggaaattagtgctgggcgtatctatataagtgccaatagg
cagctatgctaccaccactctttgaactggaccaaggtgcttcgggggcctacggaagag
cgactagacatcaagcataatcggccacgcagagactgcgtggcagagggcaaagtgtgt
gacccactgtgctcctctgggggatgctggggcccgggccctggtcagtgcttgtcctgt
cgaaactacagccgaggaggtgtctgtgtgacccactgcaactttctgaatggggagcct
cgagaatttgcccatgaggccgaatgcttctcctgccacccggaatgccaacccatggag
ggcactgccacatgcaatggctcgggctctgatacttgtgctcaatgtgcccattttcga
gatgggccccactgtgtgagcagctgcccccatggagtcctaggtgccaagggcccaatc
tacaagtacccagatgttcagaatgaatgtcggccctgccatgagaactgcacccagggg
tgtaaaggaccagagcttcaagactgtttaggacaaacactggtgctcatcggcaaaacc
catctgacaatggctttgacagtgatagcaggattggtagtgattttcatgatgctgggt
ggcacttttctctactggcgtgggcgccggattcagaataaaagggctatgaggcgatac
ttggaacggggtgagagcatagagcctctggaccccagtgagaaggctaacaaagtcttg
gccagaatcttcaaagagacagagctaaagaagcttaaagtgcttggctcgggtgtcttt
ggaactgtgcacaaaggagtgtggatccctgagggtgaatcaatcaagattccagtctgc
attaaagtcattgaggacaagagtggacggcagagttttcaagctgtgacagatcatatg
ctggccattggcagcctggaccatgcccacattgtacggctgctgggactatgcccaggg
tcatctctgcagcttgtcactcaatacttgcctctgggttctctgctggatcatgtgaga
caacaccggggggcactggggccacagctgctgctcaactggggagtacaaattgccaag
ggaatgtactaccttgaggaacatggtatggtgcatagaaacctggctgcccgaaacgtg
ctactcaagtcacccagtcaggttcaggtggcagattttggtgtggctgacctgctgcct
cctgatgataagcagctgctatacagtgaggccaagactccaattaagtggatggccctt
gagagtatccactttgggaaatacacacaccagagtgatgtctggagctatggtgtgaca
gtttgggagttgatgaccttcggggcagagccctatgcagggctgcgattggctgaagta
ccagacctgctagagaagggggagcggttggcacagccacagatctgcacaattgatgtc
tacatggtgatggtcaagtgttggatgattgatgagaacattcgcccaacctttaaagaa
ctagccaatgagttcaccaggatggccagagacccaccacggtatctggtcataaagaga
gagagtgggcctggaatagcccctgggccagagccccatggtctgacaaacaagaagcta
gaggaagtagagctggagccagaactagacctagacctagacttggaagcagaggaggac
aacctggcaaccaccacactgggctccgccctcagcctaccagttggaacacttaatcgg
ccacgtgggagccagagccttttaagtccatcatctggatacatgcccatgaaccagggt
aatcttggggagtcttgccaggagtctacagtttctgggagcaatgaacagtgcccccgt
ccagtctctctatacccaatgccacgcggatgcctggcatcagagtcatcagagggccat
gtaacacactctgaggctgagctccaggagaaagtgtcaatgtgtaggagccggagcagg
agccggagcccacggccacgcggagatagcgcctaccattcccagcgccacagtctgctt
actcctgttaccccactctccccaccagggttagaggaagaggatgtcaacggttatgtc
atgccagatacacacctcaaaggtactccctcctcccgggaaggcaccctttcttcggtg
ggtctcagttctgtcctgggtactgaagaagaagatgaagatgaggagtatgaatacatg
aaccggaggagaaggcacagtccacctcatccccctaggccaagttcccttgaggagctg
ggttatgagtacatggatgtggggtcagacctcagtgcctctctgggcagcacacagagt
tgcccactccaccctgtacccatcatgcccaatgcaggcacaactccagatgaagactat
gaatatatgaatcggcaacgaggtggaggtggtcctgggggtgattatgcagccatgggg
gcctgcccagcatctgagcaagggtatgaagagatgagagcttttcaggggcctggacat
caggccccccatgtccattatgcccgcctaaaaactctacgtagcttagaggctacagac
tctgcctttgataaccctgattactggcatagcaggcttttccccaaggctaatgcccag
agaacgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100174545
Entry
100174545         CDS       T01416                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 precursor
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04520  Adherens junction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04714  Thermogenesis
pon04810  Regulation of actin cytoskeleton
pon04928  Parathyroid hormone synthesis, secretion and action
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05215  Prostate cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100174545 (FGFR1)
   04014 Ras signaling pathway
    100174545 (FGFR1)
   04015 Rap1 signaling pathway
    100174545 (FGFR1)
   04020 Calcium signaling pathway
    100174545 (FGFR1)
   04151 PI3K-Akt signaling pathway
    100174545 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100174545 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100174545 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100174545 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100174545 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100174545 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174545 (FGFR1)
   05205 Proteoglycans in cancer
    100174545 (FGFR1)
   05230 Central carbon metabolism in cancer
    100174545 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    100174545 (FGFR1)
   05215 Prostate cancer
    100174545 (FGFR1)
   05224 Breast cancer
    100174545 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100174545 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100174545 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100174545 (FGFR1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100174545 (FGFR1)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100174545 (FGFR1)
CD molecules [BR:pon04090]
 Proteins
  100174545 (FGFR1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100174545 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_4 Ig_6 Pkinase_fungal DUF1615
Other DBs
NCBI-GeneID: 100174545
NCBI-ProteinID: NP_001127472
Ensembl: ENSPPYG00000018526
UniProt: Q5R8Q3
LinkDB
Position
8
AA seq 820 aa
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSMPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSG
TPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHT
YQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGP
DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEAL
EERPAVMTSPLYLEIIIYCAGAFLISCMVGSVIVYKTKSGTKKSDFHSQMAVHKLAKSIP
LRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGK
PLGEGCFGQVVLAEAVGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPD
TRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactctgcacc
gctaggccatccccaaccttgcctgaacaagcccagccctggggagcccctgtggaagtg
gagtccttcctggtccaccccggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtgcagagcatcaactggctgcgggacggggtgcagctggcggaaagcaaccgcacccgc
atcacaggggaggaggtggaggtgcaggactccatgcccgcagactccggcctctatgct
tgcgtaaccagcagcccctcgggcagtgacaccacctacttctccgtcaatgtttcagat
gctctcccctcctcggaggatgatgatgatgatgatgactcctcttcagaggagaaagaa
acagataacaccaaaccaaaccccgtagctccatattggacatccccagaaaaaatggaa
aagaaattgcatgcagtgccggctgccaagacagtgaagttcaaatgcccttccagtggg
accccaaaccccacactgcgctggttgaaaaatggcaaagaattcaaacctgaccacaga
attggaggctacaaggtccgttatgctacctggagcatcataatggactccgtggtgccc
tctgacaagggcaactacacctgcattgtggagaatgagtatggcagcatcaaccacacg
taccagctggatgtcgtggagcggtcccctcaccgacccatcctgcaagcagggttgccc
gccaacaagacagtggccctgggtagcaacgtggagttcatgtgtaaggtgtacagtgat
ccgcagccgcacatccagtggctaaagcacatcgaggtgaacgggagcaagattggtcca
gacaacctgccttatgtccagatcttgaagactgctggagttaataccaccgacaaagag
atggaggtgcttcacttaagaaatgtctcctttgaggacgcaggggagtatacgtgcttg
gcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaagccctg
gaagagaggccggcagtgatgacctcgcccctgtacctggagatcatcatctattgtgca
ggggccttcctcatctcctgcatggtggggtcggtcatcgtctacaagacgaagagtggt
accaagaagagcgacttccacagccagatggctgtgcacaagctggccaagagcatccct
ctgcgcagacaggtaacagtgtctgctgactccagtgcatccatgaactctggagttctt
ctggttcggccgtcacggctctcctccagtgggactcccatgctagcaggggtctctgag
tatgagcttcccgaagaccctcgctgggagctgcctcgggacagactggtcttaggcaaa
cccctgggagagggctgctttgggcaggtggtgttggcagaggctgtcgggctggacaag
gacaaacccaaccgtgtgaccaaagtggctgtgaagatgttgaagtcggacgcaacagag
aaagacttgtcagacctgatctcagaaatggagatgatgaagatgatcgggaagcataag
aatatcatcaacctgctgggggcctgcacgcaggacggtcccttgtatgtcatcgtggag
tatgcctccaagggcaacctgcgggagtacctgcaggcccggaggcccccagggctggaa
tactgctacaaccccagccacaacccagaggagcagctctcctccaaggacctggtgtcc
tgcgcctaccaggtggcccgaggcatggagtatctggcctccaagaagtgcatacaccga
gacctggcggccaggaatgtcctggtgacagaggacaatgtgatgaagatagcagacttt
ggcctcgcacgggacattcaccacatcgactactataaaaagacaaccaacggccgactg
cctgtgaagtggatggcgcccgaggcattatttgaccggatctacacccaccagagtgat
gtgtggtcttttggggtgctcctgtgggagatcttcactctgggtggctccccgtacccc
ggtgtgcctgtggaggagcttttcaagctgctgaaggagggtcaccgcatggacaagccc
agtaactgcaccaacgagctgtacatgatgatgcgggactgctggcatgcagtgccctca
cagagacccaccttcaagcagctggtggaagacctggaccgcatcgtggccttgacctcc
aaccaggagtacctggacctgtccatgcccctggaccagtactcccccagctttcccgac
acccggagctctacgtgctcctcaggggaggattccgtcttctctcatgagccgctgccc
gaggagccctgcctgccccgacacccagcccagcttgccaatggcggactcaaacgccgc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100431735
Entry
100431735         CDS       T01416                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100431735 (PDGFRA)
   04014 Ras signaling pathway
    100431735 (PDGFRA)
   04015 Rap1 signaling pathway
    100431735 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100431735 (PDGFRA)
   04020 Calcium signaling pathway
    100431735 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100431735 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100431735 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100431735 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100431735 (PDGFRA)
   04540 Gap junction
    100431735 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100431735 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431735 (PDGFRA)
   05206 MicroRNAs in cancer
    100431735 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100431735 (PDGFRA)
   05231 Choline metabolism in cancer
    100431735 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100431735 (PDGFRA)
   05218 Melanoma
    100431735 (PDGFRA)
   05215 Prostate cancer
    100431735 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100431735 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100431735 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100431735 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100431735 (PDGFRA)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100431735 (PDGFRA)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100431735 (PDGFRA)
CD molecules [BR:pon04090]
 Proteins
  100431735 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 100431735
NCBI-ProteinID: XP_009238298
Ensembl: ENSPPYG00000014767
UniProt: H2PDE4
LinkDB
Position
4
AA seq 1089 aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGENEVSWQYP
MSEEENSNVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDL
VDDHHGSTGGQMVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEVHPRD
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccggcgttcctggtcttaggctgtcttctcacagggctgagccta
atcctctgccagctttcattaccctctatccttccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagaatgaagtgagctggcagtacccc
atgtctgaagaagagaactccaatgtggaaatcagaaatgaagaaaacaacagtggcctt
tttgtgacggtcttggaagtgagcagtgcctcggcggcccacacagggttgtacacttgc
tattacaaccacactcagacagaagagaatgagcttgaaggcaggcacatttacatctat
gtgccagacccagatgtagcctttgtacctctaggaatgacggattatttagtcatcgtg
gaggatgatgattctgccatcataccttgtcgcacaactgatcccgagactcctgtaacc
ttacacaacagtgagggagtggtacctgcctcctacgacagcagacagggctttaatggg
accttcactgtagggccctatatctgtgaggccaccgtcaaaggaaagaagttccagacc
atcccatttaacgtttatgctttaaaagcaacatcagagctggatctagaaatggaagct
cttaaaaccgtgtataagtcaggggaaacgattgtggtcacctgtgctgtttttaacaat
gaggtggttgaccttcaatggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaagaaatcaaagtcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggctaccagggaggtcaaa
gaaatgaagaaagtcactatttctgtccatgagaaagggttcattgaaatcaaacccacc
ttcagccagttggaagctgtcaacctgcatgaagtcaaacattttgttgtagaggtgcgg
gcctacccacctcccaggatatcctggctgaaaaacaatctgactctgattgaaaatctc
actgagatcaccactgatgtggaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgtgctaaggaagaagacagtggccattatacaattgtagctcaaaatgaagat
gctgtgaagagctatacttttgaactgttaactcaagttccttcatcaattctggacttg
gtcgatgatcaccatggctcaactgggggacagatggtgagatgcacagctgaaggcacg
ccgcttcctgatattgagtggatgatatgcaaggatattaagaaatgtaataatgaaact
tcctggacgattttggccaacaatgtctcaaacatcatcacggaggtccacccccgagac
aggagtaccgtggagggccgtgtgactttcgccaaagtggaggagaccattgcggtgcga
tgcctggctaagaatctccttggagctgagaaccgagagctgaagctggtggctcccacc
ctgcgttctgaactcacggtggctgctgcagtcctggtgctgttggtgattgtgatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagcccggatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcaagatgggagtttccaagagatggactagtgcttggtcgggtcttgggg
tctggagcatttgggaaggtggttgaaggaacagcctatggattaagtcggtcccaacct
gtcatgaaagttgcagtgaagatgctaaaacccacggccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacatttgaacattgtaaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacggagtactgcttctatgga
gatttggtcaactatttgcataagaatagggatagcttcctgagccaccacccagagaag
ccaaagaaagagctggatatctttggattgaaccctgctgatgaaagcacacggagctat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgatactaca
cagtatgtccccatgctagaaagaaaagaggtttctaaatattccgacatccagagatca
ctctatgatcgtccagcctcatataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggccttactttattggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgtgatctggct
gctcgcaacgtcctcctggcacaaggaaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcaaactatgtgtcaaaaggcagtacctttctgcccgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagtgatgtctggtct
tacggcattctgctctgggagatcttttcccttggtggcaccccttaccccggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggctaagcctgaccat
gctaccagtgaagtctacgagatcatggtgaaatgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaaaattcacctggacttcctgaagagtgaccatcctgctgtggcacgcatg
cgtgtggactcagacaatgcgtacattggtgtcacctacaaaaacgaggaagacaagctg
aaggactgggagggtggtctggatgagcagagactgagcgctgacagtggctacatcatt
cctctgcctgacattgaccctgtccctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccattgagacgggttccagcagttccaccttcatc
aagagagaggacgagaccattgaagacatcgacatgatggacgacatcggcatagactct
tcagacctggtagaagacagcttcctgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100433126
Entry
100433126         CDS       T01416                                 

Gene name
FGFR3
Definition
(RefSeq) LOW QUALITY PROTEIN: fibroblast growth factor receptor 3
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05219  Bladder cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100433126 (FGFR3)
   04014 Ras signaling pathway
    100433126 (FGFR3)
   04015 Rap1 signaling pathway
    100433126 (FGFR3)
   04020 Calcium signaling pathway
    100433126 (FGFR3)
   04151 PI3K-Akt signaling pathway
    100433126 (FGFR3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100433126 (FGFR3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100433126 (FGFR3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100433126 (FGFR3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100433126 (FGFR3)
   05206 MicroRNAs in cancer
    100433126 (FGFR3)
   05230 Central carbon metabolism in cancer
    100433126 (FGFR3)
  09162 Cancer: specific types
   05219 Bladder cancer
    100433126 (FGFR3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100433126 (FGFR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100433126 (FGFR3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100433126 (FGFR3)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100433126 (FGFR3)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100433126 (FGFR3)
CD molecules [BR:pon04090]
 Proteins
  100433126 (FGFR3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig FGFR3_TM V-set C2-set_2 Pkinase_fungal DUF1533
Other DBs
NCBI-GeneID: 100433126
NCBI-ProteinID: XP_024102130
LinkDB
Position
4
AA seq 806 aa
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVLGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRXPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAVGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSC
SSSGDDSVFAHDLLPPAPPSSGGSRT
NT seq 2421 nt   +upstreamnt  +downstreamnt
atgggcgcccctgcctgcgccctcgcgctctgcgtggccgtggccatcgtggccggcgcc
tcctcggagtccttggggacggagcagcgcgtcgtggggcgagcggcagaagtcctgggc
ccagagcccggccagcaggagcagttggtcttcggcagcggggatgctgtggagctgagc
tgtcccccgcccgggggtggtcccatggggcccactgtctgggtcaaggatggcacaggg
ctggtgccctcggagcgtgtcctggtggggccccagcggctgcaggtgctgaatgcctcc
cacgaggactccggggcctacagctgccggcagcggctcacgcagcgcgtactgtgccac
ttcagtgtgcgggtgacagacgctccatcctcaggagatgacgaagacggggaggacgag
gctgaggacacaggtgtggacacaggggccccttactggactcggcccgagcggatggac
aagaagctgctggccgtgccggccgccaacaccgtccgcttccgctgcccggccgccggc
aaccccactccctccatctcctggctgaagaatggcaaggagttccgcggcgagcaccgc
atcggaggcatcaagctgcggcaccagcagtggagcctggtcatggaaagcgtggtgccc
tcagaccgcggcaactacacctgcgtagtggagaacaagtttggcagcatccggcagaca
tacacgctggatgtgctggagcgctccccgcaccggcccatcctgcaggcggggctgccg
gccaaccagacggcggtgctgggcagcgatgtggagttccactgcaaggtgtacagtgac
gcacagccccacatccagtggctcaagcacgtggaggtgaacggcagcaaggtgggcccg
gacggcacaccctacgttaccgtgctcaagacggcgggcgctaacaccaccgacaaggag
ctagaggttctgtccttgcacaacgtcacctttgaggacgccggggagtacacctgcctg
gcgggcaattctattgggttttctcatcactctgcgtggctggtggtgctgccagctgag
gaggagctggtggaggctgacgaggcgggcagtgtgtatgcaggcatcctcagctacggg
gtgggcttcttcttgttcatcctggtggtggcggctgtgacgctctgccgcctacgcnag
ccccccaagaaaggcctgggctcccccaccgtgcacaagatctcccgcttcccgctcaag
cgacaggtgtccctggagtccaacgcgtccatgagctccaacacaccgctggtgcgcatc
gcaaggctgtcctcaggggagggccccacgctggccaatgtctccgagcttgagctgcct
gccgaccccaaatgggagctgtctcgggcccggctgaccctgggcaagccccttggggag
ggctgcttcggtcaggtggtcatggcagaggccgtcggcattgacaaggaccgggccgcc
aagcctgtcaccgtagccgtgaagatgctgaaagacgatgccactgacaaggacctgtcg
gacctggtgtctgagatggagatgatgaagatgattggcaaacacaagaacatcatcaac
ctgctgggcgcctgcacgcagggtgggcccctgtacgtgctggtggagtacgcggctaag
ggtaacttgcgggagttcctgcgggcgcggcggcccccgggcctggactactccttcgac
acctgcaagccacccgaggagcagctcaccttcaaggacctggtgtcctgtgcctaccag
gtggcccggggcatggagtacctggcctcccagaagtgcatccacagggacctggctgcc
cgcaatgtgctggtgaccgaggacaatgtgatgaagatcgcagacttcgggctggcccgg
gacgtgcacaacctcgactactacaagaagacaaccaacggccggctgcccgtgaagtgg
atggcgcctgaggccttgtttgaccgagtctacactcaccagagtgacgtctggtccttt
ggggtcctgctctgggagatcttcacgctagggggctccccgtaccccggtatccctgtg
gaggagctcttcaagctgctgaaggagggacaccgcatggacaagcccgccaactgcaca
cacgacctgtacatgatcatgcgggagtgctggcatgctgcaccctcccagaggcccacc
ttcaagcagctggtggaggacctggaccgtgtccttaccgtgacatccaccgatgagtac
ctggacctgtcggcgcctttcgagcagtactctcctggtggccaggacacccccagctgc
agctcctcaggggatgactccgtgtttgcccacgacctgctgcccccggccccacccagc
agtgggggctcgcggacgtga

KEGG   Pongo abelii (Sumatran orangutan): 100433386
Entry
100433386         CDS       T01416                                 

Gene name
CSF1R
Definition
(RefSeq) macrophage colony-stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04151  PI3K-Akt signaling pathway
pon04380  Osteoclast differentiation
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100433386 (CSF1R)
   04014 Ras signaling pathway
    100433386 (CSF1R)
   04015 Rap1 signaling pathway
    100433386 (CSF1R)
   04151 PI3K-Akt signaling pathway
    100433386 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100433386 (CSF1R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100433386 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100433386 (CSF1R)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100433386 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100433386 (CSF1R)
   05202 Transcriptional misregulation in cancer
    100433386 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100433386 (CSF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100433386 (CSF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100433386 (CSF1R)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100433386 (CSF1R)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100433386 (CSF1R)
CD molecules [BR:pon04090]
 Proteins
  100433386 (CSF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 Izumo-Ig Serglycin C2-set_2 AF-4
Other DBs
NCBI-GeneID: 100433386
NCBI-ProteinID: XP_024103185
Ensembl: ENSPPYG00000015942
LinkDB
Position
5
AA seq 983 aa
MGPGVLLLLLVATAWHGQGIPVIEPSGPELVVKPGAMVTLRCVGNGSVEWDGSVEWDGPV
SPHWTLHSDGSSSVLTNNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQE
VVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQD
YQCSALMGGRKVMSISIRLKVQKVIPGPPALTLAPAELVRIRGEAAQIVCSASNVDVNFD
VFLQHNDTKLTIPQQSDFHNNRYQKVLTFNLDQVDFQHAGNYSCVANNVQGKHSTSMFFR
VVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANA
TIKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGS
GTLVCAASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTV
ETLEHNQTYECRAHNSVGSGSWAFIPISAGARTHPPDEFLFTPVVVACMSIMALLLLLLL
LLLYKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFG
KVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACT
HGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPKGGVDYKNIHLEKKYVHRDSG
FSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELWDLLHFSSQVAQGMAFLASKNC
IHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCIYTV
QSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWA
LEPTHRPTFQQICSFLQEQAQEDRRQQDYTNLPSSSRSGGSGSGSGSGSSSELEEESASE
HLTCCEQGDIAQPLLQPNNYQFC
NT seq 2952 nt   +upstreamnt  +downstreamnt
atgggcccaggagttctgctgctcctgctggtggccacagcttggcatggtcagggaatc
ccagtgatagagcccagtggccctgagctggtcgtgaagccaggagcaatggtgaccctg
cgatgtgtgggcaatggcagcgtggaatgggatggcagcgtggaatgggatggccccgta
tcacctcactggaccctgcactctgatggctccagcagcgtcctcaccaacaacaacgct
accttccaaaacacggggacctatcgctgcactgagcctggagaccccctgggaggcagt
gctgccatccacctctatgtcaaagaccctgcccggccctggaacgtgctagcacaggag
gtggtcgtgttcgaggaccaggacgcactgctgccctgtctgctcacagacccggtgctg
gaagcaggcgtctcgctggtgcgtgtgcgtggccggcccctcatgcgccacaccaactac
tccttctcgccttggcatggcttcaccatccacagggccaagttcattcagagccaggac
tatcaatgcagtgccctgatgggtggcaggaaggtgatgtccatcagcatccggctgaaa
gtgcagaaagtcatcccagggcccccagccttgacactggcgcctgcagagctggtgcgg
attcgaggggaggctgcccagatcgtgtgctcagccagcaacgttgatgttaactttgat
gtcttcctccaacacaacgacactaagctcacaatccctcaacaatctgactttcataat
aaccgttaccaaaaagtcctgaccttcaacctcgatcaagtagatttccaacatgccggc
aactactcctgcgtggccaacaatgtgcagggcaagcactccacctccatgttcttccgg
gtggtagagagtgcctacttgaacttgagctctgagcagaacctcatccaggaggtgacc
gtgggggaggggctcaacctcaaagtcatggtggaggcctacccaggcctgcaaggtttt
aactggacctacctgggacccttttctgaccaccagcctgagcccaagcttgctaatgct
accatcaaggacacatacaggcacaccttcaccctctctctgccccgcctgaagccctct
gaggctggccgctactccttcctagccagaaacccaggaggctggagagctctgacgttt
gagctcacccttcgataccccccagaggtaagtgtcatatggaccttcatcaatggctct
ggcacccttgtgtgtgctgcctccgggtacccccagcccaacgtgacatggctgcagtgc
agtggccacactgataggtgtgatgaggcccaagtgctgcaggtctgggatgacccatac
cctgaggtcctgagccaggagcccttccacaaggtgaccgtgcaaagcctgctgactgtt
gagaccttagagcacaaccaaacctacgagtgcagggcccacaacagcgtggggagtggc
tcctgggccttcatacccatctctgcaggagcccgcacgcatcccccagatgagttcctc
ttcacaccagtggtggtcgcctgcatgtccatcatggccttactgctgctgctgctcctg
ctgctattgtacaagtataagcagaagcccaagtaccaggtccgctggaagatcatcgag
agctatgagggcaacagttacactttcatcgaccccacacagctgccttacaacgagaag
tgggagttcccccggaacaacctgcagtttggtaagaccctcggagctggcgcctttggg
aaggtggtggaggccacggcctttggtctgggcaaagaggatgctgtcctgaaggtggct
gtgaagatgctgaagtccacggcccatgctgatgagaaggaggccctcatgtccgagctg
aagatcatgagccacctgggccagcacgagaacatcgtcaaccttctgggagcctgcacc
catggaggccctgtactggtcatcacggagtactgttgctatggcgacctgctcaacttt
ctgcgaaggaaggctgaggccatgctgggacccagcctgagccccggccaggaccccaag
ggaggcgtcgactataagaacatccacctcgagaagaaatatgtccacagggacagtggc
ttctccagccagggtgtggacacctatgtggagatgaggcctgtctccacttcttcaaat
gactccttctctgagcaagacctggacaaggaggatggacggcccctggagctctgggac
ctgcttcacttctccagccaagtagcccagggcatggccttcctcgcttctaagaattgc
atccaccgggatgtggcagcacgtaacgtgctgttgaccaatggtcatgtggccaagatt
ggggacttcgggctggctagggacatcatgaatgactccaactacatcgtcaagggcaat
gcccgcctgcctgtgaagtggatggccccagagagcatctttgactgtatctacacggtt
cagagcgacgtctggtcctatggcatcctcctctgggagatcttctcgcttgggctgaat
ccctaccctggcatcctggtgaacagcaagttctataaactggtgaaggatggataccaa
atggcccagcctgcatttgccccaaagaatatatacagcatcatgcaggcctgctgggcc
ttggagcccacccacagacccaccttccagcagatctgctccttccttcaggagcaggcc
caagaggacaggagacagcaggactataccaatctgccgagcagcagcagaagcggtggc
agcggcagcggcagcggcagcggcagcagcagtgaactggaggaggagagcgctagtgag
cacctgacctgctgcgagcaaggggatatcgcccagcccttgctgcagcccaacaactat
cagttctgctga

KEGG   Pongo abelii (Sumatran orangutan): 100437110
Entry
100437110         CDS       T01416                                 

Gene name
KIT
Definition
(RefSeq) mast/stem cell growth factor receptor Kit isoform X1
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04640  Hematopoietic cell lineage
pon04916  Melanogenesis
pon05200  Pathways in cancer
pon05221  Acute myeloid leukemia
pon05224  Breast cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100437110 (KIT)
   04014 Ras signaling pathway
    100437110 (KIT)
   04015 Rap1 signaling pathway
    100437110 (KIT)
   04072 Phospholipase D signaling pathway
    100437110 (KIT)
   04151 PI3K-Akt signaling pathway
    100437110 (KIT)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100437110 (KIT)
  09152 Endocrine system
   04916 Melanogenesis
    100437110 (KIT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100437110 (KIT)
   05230 Central carbon metabolism in cancer
    100437110 (KIT)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100437110 (KIT)
   05224 Breast cancer
    100437110 (KIT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100437110 (KIT)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100437110 (KIT)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100437110 (KIT)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100437110 (KIT)
CD molecules [BR:pon04090]
 Proteins
  100437110 (KIT)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 Ig_6 Ig_4 V-set Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100437110
NCBI-ProteinID: XP_024102193
LinkDB
Position
4
AA seq 977 aa
MRGARGAWDFLCVLLLLLRVQTGSSQPSASPGEPSPPSIHPAKSELIVRVGDEIRLLCTD
TGFVKWTFEILDEMNENKQNEWITEKAEATNTGKYTCTNKHGLSSSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFVPDPKAGIMIKSVKRAYH
RLCLHCSADQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSA
NVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPRPEHQHWIYMNRTFTDKW
EDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNASIAFNVYVNTKPEILTYD
RLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSVD
SSAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCII
VMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGA
FGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGA
CTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTN
EYMDMKPGVSYVVPTKADKRRSARIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKG
MAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPE
SIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEM
YDIMKTCWDVDPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINS
VGSTASSSQPLLVHDDV
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggattttctctgcgttctgctcctactgcttcgcgtc
cagacaggctcttctcaaccatctgcgagtccaggggaaccgtctccaccatccatccat
ccagcaaaatcagagttaatagtccgcgtgggcgatgagattaggctgttatgcactgat
acgggctttgtcaaatggacttttgagatcctcgatgaaatgaatgagaataagcagaat
gaatggatcacagaaaaggcagaagccaccaacaccggcaaatacacctgcaccaacaaa
cacggcttaagcagttccatttatgtgtttgttagagatcctgccaagcttttccttgtt
gaccgctccttgtatgggaaagaagacaacgacacgctggtccgctgtcctctcacagac
ccagaagtgaccaattattccctcaaggggtgccaggggaagcctcttcccaaggacttg
aggtttgttcctgaccccaaggcgggcatcatgatcaaaagtgtgaaacgcgcctaccat
cggctctgtctgcattgttccgcggaccaggagggcaagtcagtgctgtcggaaaaattc
atcctgaaagtgaggccagccttcaaagctgtgcctgttgtgtctgtgtccaaagcaagc
tatcttcttagggaaggggaagaattcacagtgacgtgcacaataaaagatgtgtctagt
tctgtgtactcaacgtggaaaagagaaaacagtcagcagactaaactacaggagaaatat
aatagctggcatcacggtgacttcaattatgaacgtcaggcaacgttgactatcagttca
gcgagagttaatgattctggagtgttcatgtgttatgccaataatacttttggatcagca
aatgtcacaacaaccttggaagtagtagataaaggattcattaatatcttccccatgata
aacactacagtatttgtaaacgatggagaaaatgtagatttgattgttgaatatgaggca
ttccccagacctgaacaccagcactggatctatatgaacagaaccttcactgataaatgg
gaagattatcccaagtctgagaatgaaagtaatatcagatacgtaagtgaacttcatcta
accagattaaaaggcaccgaaggaggcacttacacattcctagtgtccaattctgacgtc
aatgcttccatagcatttaatgtttatgtgaatacaaaaccagaaatcctgacttacgac
aggctcgtgaatggcatgctccaatgtgtggcagcaggattcccagagcccacaatagat
tggtatttttgtccaggaactgagcagagatgctctgcttctgtactgccagtggatgtg
cagacactaaactcatctgggccaccgtttggaaagctagtggttcagagttctgtagat
tctagtgcattcaagcacaatggcacggttgaatgtaaggcttacaacgatgtgggcaag
acttctgcctattttaactttgcatttaaaggtaacaacaaagagcaaatccatccccac
accctgttcactcctttgctgattggtttcgtaatcgtagctggcatgatgtgcattatt
gtgatgattctgacctacaaatatttacagaaacccatgtatgaagtacagtggaaggtt
gttgaggagataaatggaaacaattatgtttacatagacccaacacaacttccttatgat
cacaaatgggagtttcccagaaacaggctgagttttgggaaaaccctgggtgctggtgct
ttcgggaaagttgttgaggcaactgcttatggcttaattaagtcagatgcggctatgact
gtagctgtaaagatgctcaaaccaagtgcccatttaacagaacgggaagccctcatgtct
gaactcaaagtcttgagttaccttggtaatcatatgaatattgtgaatcttcttggagcc
tgcaccattggagggcccaccttggtcattacagaatattgttgctatggtgatcttttg
aattttttgagaagaaaacgtgattcatttatttgttcaaagcaggaagatcatgcagaa
gctgcactttataagaatcttctgcattcaaaggagtcttcctgcagcgatagtaccaat
gagtacatggacatgaaacctggagtctcttatgttgtcccaaccaaggccgacaaaagg
agatctgcgagaataggctcatacatagaaagagatgtgactcctgccatcatggaggat
gatgagttggccctagacttagaagacttgctgagcttttcttaccaggtggcaaagggc
atggccttcctcgcctccaagaattgtattcacagagacttggcagccagaaatatcctc
cttactcatggtcggatcacaaagatttgtgattttggtctagccagagacatcaagaat
gattctaattatgtggttaaaggaaacgctcgactacctgtgaagtggatggcacctgaa
agcattttcaactgtgtatacacgtttgaaagtgacgtctggtcctatggtatttttctt
tgggagctgttctctttaggaagcagcccctatcctggaatgccggtcgattctaagttc
tacaagatgatcaaggaaggcttccggatgctcagccctgaacatgcacctgctgaaatg
tatgacataatgaagacttgctgggatgtggatcccctaaaaagaccaacattcaagcaa
attgttcagctaattgagaagcagatttcagagagcactaatcacatttactccaactta
gcaaactgcagccccaaccgacagaagcccgtggtggaccattctgtgcggatcaattct
gtcggcagcaccgcttcctcctcccagcctctgcttgtgcacgatgacgtctga

KEGG   Pongo abelii (Sumatran orangutan): 100441207
Entry
100441207         CDS       T01416                                 

Gene name
NTRK2
Definition
(RefSeq) BDNF/NT-3 growth factors receptor isoform X2
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04722  Neurotrophin signaling pathway
pon05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100441207 (NTRK2)
   04014 Ras signaling pathway
    100441207 (NTRK2)
   04020 Calcium signaling pathway
    100441207 (NTRK2)
   04151 PI3K-Akt signaling pathway
    100441207 (NTRK2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100441207 (NTRK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    100441207 (NTRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100441207 (NTRK2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100441207 (NTRK2)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   100441207 (NTRK2)
SSDB
Motif
Pfam: I-set Ig_3 TPKR_C2 Ig_2 ig LRR_8 LRRNT V-set LRR_5 Ig_C17orf99
Other DBs
NCBI-GeneID: 100441207
NCBI-ProteinID: XP_009242828
Ensembl: ENSPPYG00000019331
LinkDB
Position
9
AA seq 553 aa
MSSWIRWHGPAMTRLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGKVKSRQG
VGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQL
KPDTWPRGSPKIA
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgtcgtcctggataaggtggcatggacccgccatgacgcggctctggggcttctgctgg
ctggttgtgggcttctggagggccgctttcgcctgtcctacgtcctgcaaatgcagtgcc
tctcggatctggtgcagcgacccttctcctggcatcgtggcatttccgagattggagcct
aacagtgtagatcctgagaacatcaccgaaattttcatcgcaaaccagaaaaggttagaa
atcatcaacgaagatgatgttgaagcttatgtgggactgagaaatctgacaattgtggat
tctggattaaaatttgtggctcataaagcatttctgaaaaacagcaacctgcagcacatc
aattttactcgaaacaaactgacgagtttgtctaggaaacatttccgtcaccttgacttg
tctgaactgatcctggtgggcaatccatttacatgctcctgtgacattatgtggatcaag
actctccaagaggctaaatccagtccagacactcaagatttgtactgcctgaatgaaagc
agcaagaatattcccctggcaaacctgcagatacccaattgtggtttgccatctgcaaat
ttggccgcacctaacctcactgtggaggaaggaaagtctatcacattatcctgtagtgtg
gcaggcgatccggttcctaatatgtattgggatgttggtaatctggtttccaaacatatg
aatgaaacaagccacacacagggctccttaaggataactaacatttcatccgatgacagt
gggaagcagatctcttgtgtggcggaaaatcttgtaggagaagatcaagattctgtcaac
ctcactgtgcattttgcaccaactatcacatttctcgaatctccaacctcagaccaccac
tggtgcattccattcactgtgaaaggcaaccccaaaccagcgcttcagtggttctataac
ggggcaatattgaatgagtccaaatacatctgtactaaaatacatgttaccaatcacacg
gagtaccacggctgcctccagctggataatcccactcacatgaacaatggggactacact
ctaatagccaagaatgagtatgggaaggatgagaaacagatttctgctcacttcatgggc
tggcctggaattgacgatggtgcaaacccaaattatcctgatgtaatttatgaagattat
ggaactgcagcgaatgacatcggggacaccacgaacagaagtaatgaaatcccttccaca
gacgtcactgataaaaccggtcgggaacatctctcggtctatgctgtggtggtgattgcg
tctgtggtgggattttgccttttggtaatgctgtttctgcttaagttggcaagacactcc
aagtttggcatgaaagatttctcatggtttggatttgggaaagtaaaatcaagacaaggt
gttggcccagcttccgttatcagcaatgatgatgactctgccagcccactccatcacatc
tccaatgggagtaacactccatcttcttcagaaggtggcccagatgctgtcattattgga
atgaccaagatccctgtcatagaaaatccccagtactttggcatcaccaacagtcagctc
aagccagacacatggcccagaggttcccccaagatcgcctga

KEGG   Pongo abelii (Sumatran orangutan): 100450307
Entry
100450307         CDS       T01416                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X1
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04530  Tight junction
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05215  Prostate cancer
pon05219  Bladder cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100450307 (ERBB2)
   04012 ErbB signaling pathway
    100450307 (ERBB2)
   04066 HIF-1 signaling pathway
    100450307 (ERBB2)
   04020 Calcium signaling pathway
    100450307 (ERBB2)
   04151 PI3K-Akt signaling pathway
    100450307 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100450307 (ERBB2)
   04520 Adherens junction
    100450307 (ERBB2)
   04530 Tight junction
    100450307 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450307 (ERBB2)
   05206 MicroRNAs in cancer
    100450307 (ERBB2)
   05205 Proteoglycans in cancer
    100450307 (ERBB2)
   05230 Central carbon metabolism in cancer
    100450307 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100450307 (ERBB2)
   05226 Gastric cancer
    100450307 (ERBB2)
   05219 Bladder cancer
    100450307 (ERBB2)
   05215 Prostate cancer
    100450307 (ERBB2)
   05213 Endometrial cancer
    100450307 (ERBB2)
   05224 Breast cancer
    100450307 (ERBB2)
   05223 Non-small cell lung cancer
    100450307 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100450307 (ERBB2)
   01524 Platinum drug resistance
    100450307 (ERBB2)
   01522 Endocrine resistance
    100450307 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100450307 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100450307 (ERBB2)
   04090 CD molecules [BR:pon04090]
    100450307 (ERBB2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100450307 (ERBB2)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100450307 (ERBB2)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100450307 (ERBB2)
CD molecules [BR:pon04090]
 Proteins
  100450307 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 100450307
NCBI-ProteinID: XP_024090162
Ensembl: ENSPPYG00000008479
LinkDB
Position
17
AA seq 1267 aa
MARTNAVQHRDSDPDSHACAGSDESDMYCCGHAQKRVCTGTDMKLRLPASPETHLDMLRH
LYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLF
EDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIERNPQLCYQDTIL
WKDIFHKNNQLAVTLIDTNRSRACHPCSSVCKGSRCWGESSEDCQSLTRTVCAGGCARCK
GPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGR
YTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGME
HLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLRVFETLEEITG
YLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALI
HHNTRLCFVHTVPWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQC
VNCSQFLRGQECVEECRVLQGLPREYVNARYCLPCHPECQPQNGSVTCFGPEADQCVACA
HYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGTCQPCPINCTHSCVDLDDKGCPAEQRA
SPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPN
QAQMRILKETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEIL
DEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQ
IAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKW
MALESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICT
IDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSL
LEDDDMGDLVDAEEYLVPQQGFFCPDPAPGVGGMVHHRHRSSSTRSGGGDLTLGLEPSEE
EAPRSPLAPSDGAGSDVFDGDLGMGAAKGLQSLPAHDPSPLQRYSEDPTVPLPSETDGYV
APLTCSPQPEYVNQPDVRPQPPSPREGPLPPARPAGATLERPKTLSPGKNGVVKDVFAFG
GAVENPEYLAPRGGAAPQPHPPPAFSPAFDNLYYWDQDPSERGAPPSTFKGTPTAENPEY
LGLDVPV
NT seq 3804 nt   +upstreamnt  +downstreamnt
atggccaggacaaacgcagtgcagcacagagactcagaccctgacagccatgcctgcgca
ggcagtgatgagagtgacatgtactgttgtggacacgcacaaaagcgagtgtgcaccggc
acagacatgaagctgcggctccctgccagtcccgagacccacctggacatgctccgccac
ctctaccagggctgccaggtggtgcaaggaaacctggaactcacctacctgcccaccaat
gccagcctctccttcctgcaggatatccaggaggtgcagggctacgtgctcatcgctcac
aaccaagtgaggcaggtcccactgcagaggctgcggattgtgcgaggcacccagctcttt
gaggacaactatgccctggccgtgctagacaatggagacccgctgaacaataccacccct
gtcacaggggcctccccaggaggcctgcgggagctgcagcttcgaagcctcacagagatc
ttgaaaggaggggtcttgatcgagcggaacccccagctctgctaccaggacacgattttg
tggaaggacatcttccacaagaacaaccagctggctgtcacactgatagacaccaaccgc
tctcgggcctgccacccctgttcttcggtgtgtaagggctcccgctgctggggagagagt
tctgaggattgtcagagcctgacgcgcactgtctgtgccggtggctgtgcccgctgcaag
gggccactgcccactgactgctgccatgagcagtgtgctgccggctgcacgggccccaag
cactctgactgcctggcctgcctccacttcaaccacagtggcatctgtgagctgcactgc
ccagccctggtcacctacaacacagacacctttgagtccatgcccaatcccgagggccga
tatacattcggcgccagctgtgtgactgcctgtccctacaactacctttctacggacgtg
ggatcctgcaccctcgtctgccccctgcacaaccaagaggtgacagcagaggacggaaca
cagcggtgtgagaagtgcagcaagccctgtgcccgagtgtgctatggtctgggcatggag
cacttgcgagaggtgagggcagtcaccagtgccaatatccaggagtttgctggctgcaag
aagatctttgggagcctggcatttctgccggagagctttgatggggacccagcctccaac
accgccccgctccagccagagcagctccgagtgtttgagactctggaagagatcacaggt
tacctatacatctcagcatggccagacagcctgcctgacctcagcgtcttccagaacctg
caagtaatccggggacgaattctgcacaatggcgcctactcgctgaccctgcaagggctg
ggcatcagctggctggggctgcgctcgctgcgggaactgggcagtggactggccctcatc
caccataacacccgcctctgcttcgtgcacacggtgccctgggaccagctcttccggaac
ccgcaccaagctctgctccacactgccaaccggccagaggacgagtgtgtgggcgagggc
ctggcctgccaccagctgtgcgcccgagggcactgctggggtccagggcccacccagtgt
gtcaactgcagccagttccttcggggccaggagtgcgtggaggaatgccgagtactgcag
gggctccccagggagtatgtgaatgccaggtactgtttgccgtgccaccctgagtgtcag
ccccagaatggctcagtgacctgttttggaccggaggctgaccagtgtgtggcctgtgcc
cactataaggaccctcccttctgcgtggcccgctgccccagcggtgtgaaacctgacctc
tcctacatgcccatctggaagtttccagatgaggagggcacgtgccagccttgccccatc
aactgcacccactcctgtgtggacctggatgacaagggctgccccgccgagcagagagcc
agccctctgacgtccatcatctctgcggtggtgggcattctgctggtcgtggtcttgggg
gtggtctttgggatcctcatcaagcgacggcagcagaagatccggaagtacacgatgcgg
aggctgctgcaggaaacggagctggtggagccgctgacacctagcggagcgatgcccaac
caggcgcagatgcgtatcctgaaagagacggagctgaggaaggtgaaggtgcttggatct
ggcgcttttggcacagtctacaagggcatctggatccctgatggggaaaatgtgaaaatt
ccagtggccatcaaagtgttgagggaaaacacatcccccaaagccaacaaagaaatctta
gacgaagcatacgtgatggctggtgtgggctccccatatgtctcccgcctcctgggcatc
tgcctgacatccacggtgcagctggtgacacagcttatgccctatggctgcctcttagac
catgtccgggaaaaccgcggacgcctgggctcccaggacctgctgaactggtgtatgcag
attgccaaggggatgagctacctggaggatgtgcggctcgtacacagggacttggctgct
cggaacgtgctggtcaagagtcccaaccatgtcaaaattacagacttcgggctggctcgg
ctgctggacattgacgagacagagtaccatgcagatgggggcaaggtgcccatcaagtgg
atggcgctggagtccattctccgccggcggttcacccaccagagtgatgtgtggagttat
ggtgtgactgtgtgggagctgatgacttttggggccaaaccttacgatgggatcccagcc
cgggagatccctgacctgctggaaaagggggagcggctgccccagcctcccatctgcacc
attgatgtctacatgatcatggtcaaatgttggatgattgactctgaatgtcggccgaga
ttccgggagttggtgtctgaattctcccgcatggccagggacccccagcgctttgtggtc
atccagaatgaggacttgggcccagccagtcccttggacagcaccttctaccgctcactg
ctggaggacgatgacatgggggacctggtggatgctgaggagtatctggtaccccagcag
ggcttcttctgtccagaccctgccccgggagttgggggcatggtccaccacaggcaccgc
agctcatctaccaggagtggcggtggggacctgacgctagggctggagccctctgaagag
gaggcccccaggtctccactggcaccctccgatggggctggctccgatgtatttgatggt
gacctgggaatgggggcagccaaggggctgcaaagcctccccgcacatgaccccagccct
ctacagcggtacagtgaggaccccacagtacccctgccctctgagactgatggctacgtt
gcccccctgacctgcagcccccagcccgaatatgtgaaccagccagatgttcggccacag
cctccttcgccccgagagggccctctgcctcctgcccgacctgctggtgccactctggaa
aggcctaagactctctccccagggaagaatggggttgtcaaagacgtttttgcctttggg
ggtgccgtggagaaccccgagtacttggcaccccggggaggagctgcccctcagccccac
cctcctcctgccttcagcccagccttcgacaacctctattactgggaccaggacccatca
gagcggggggctccacccagcaccttcaaagggacacctacggcagaaaacccagagtac
ctgggtctggacgtgccagtgtga

KEGG   Pongo abelii (Sumatran orangutan): 100451422
Entry
100451422         CDS       T01416                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04072  Phospholipase D signaling pathway
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04520  Adherens junction
pon04910  Insulin signaling pathway
pon04913  Ovarian steroidogenesis
pon04923  Regulation of lipolysis in adipocytes
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04960  Aldosterone-regulated sodium reabsorption
pon05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100451422 (INSR)
   04014 Ras signaling pathway
    100451422 (INSR)
   04015 Rap1 signaling pathway
    100451422 (INSR)
   04066 HIF-1 signaling pathway
    100451422 (INSR)
   04068 FoxO signaling pathway
    100451422 (INSR)
   04072 Phospholipase D signaling pathway
    100451422 (INSR)
   04022 cGMP-PKG signaling pathway
    100451422 (INSR)
   04151 PI3K-Akt signaling pathway
    100451422 (INSR)
   04152 AMPK signaling pathway
    100451422 (INSR)
   04150 mTOR signaling pathway
    100451422 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100451422 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100451422 (INSR)
   04923 Regulation of lipolysis in adipocytes
    100451422 (INSR)
   04913 Ovarian steroidogenesis
    100451422 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100451422 (INSR)
  09149 Aging
   04211 Longevity regulating pathway
    100451422 (INSR)
   04213 Longevity regulating pathway - multiple species
    100451422 (INSR)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100451422 (INSR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100451422 (INSR)
   04932 Non-alcoholic fatty liver disease
    100451422 (INSR)
   04931 Insulin resistance
    100451422 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100451422 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100451422 (INSR)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100451422 (INSR)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100451422 (INSR)
CD molecules [BR:pon04090]
 Proteins
  100451422 (INSR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like Insulin_TMD fn3 Kinase-like B2 DUF4476
Other DBs
NCBI-GeneID: 100451422
NCBI-ProteinID: XP_024092866
LinkDB
Position
19
AA seq 1370 aa
MGTGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRPSRKRRSLGDVGNVTAAVPTVAAFPNTSSTSVPTSP
EEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADD
IVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR
LRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVI
GSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLLRELGQG
SFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGV
VSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNA
KKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGV
FTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMC
WQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRS
SHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS
NT seq 4113 nt   +upstreamnt  +downstreamnt
atgggcaccgggggccggcggggggcggcggccgcgccgctgctggtggcggtggccgcg
ctgctattgggcgccgcgggccacctgtaccccggagaggtgtgtcccggcatggatatc
cggaacaacctcactaggttgcatgagctggagaattgctctgtcatcgaaggacacttg
cagatactcttaatgttcaaaacgaggcccgaagatttccgagacctcagtttccccaaa
ctcataatgatcactgattacttgctgctcttccgggtctatgggctcgagagcctgaag
gacctgttccccaacctcacggtcatccggggatcacgactgttctttaactacgcgctg
gtcatcttcgagatggttcacctcaaggaactcggcctctacaacctgatgaacatcacc
cggggttctgtccgcatcgagaagaacaatgagctctgttacttggccactatcgactgg
tcccgtatcctggattccgtggaggataattacatcgtattgaacaaagatgacaatgag
gagtgtggagacatctgtccgggtaccgcaaagggcaagaccaactgccccgccactgtc
atcaatgggcagtttgtcgaacgctgttggactcatagtcactgccagaaagtttgcccg
accatctgtaagtcacacggctgcaccgccgaaggcctctgttgccacagcgagtgcctg
ggcaactgttctgagcccgacgaccccaccaagtgcgtggcctgccgcaacttctacctg
gacggcaggtgtgtggagacctgcccgcccccgtactaccacttccaggactggcgctgt
gtgaacttcagcttctgccaggacctgcaccacaaatgcaagaactcgcggaggcagggc
tgccaccagtacgtcattcacaacaacaagtgcatccctgagtgtccctccgggtacacg
atgaattccagcaacttgctgtgcaccccatgcctgggtccctgtcccaaggtgtgccac
ctcctagaaggcgagaagaccatcgactcggtgacatctgcccaggagctccgaggatgc
accgtcatcaacgggagtctgatcatcaacattcgaggaggcaacaatctggcagctgag
ctagaagccaacctcggcctcattgaagaaatttcagggtatctaaaaatccgccgatcc
tacgctctggtgtcactttccttcttccggaagttacgtctgattcgaggagagaccttg
gaaatcgggaactactccttctatgccttggacaaccagaacctaaggcagctctgggat
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccactataaccccaaa
ctctgcttgtcagaaatccacaagatggaagaagtttcaggaaccaaggggcgccaggag
agaaacgacattgccctgaagaccaatggggaccaggcatcctgtgaaaatgagttactt
aaattttcttacattcggacatcttttgacaagatcttgctgagatgggagccgtactgg
ccccccgacttccgagacctcttggggttcatgctgttctacaaagaggccccttatcag
aatgtgacggagttcgacgggcaggatgcgtgtggttccaacagctggacggtggtagac
attgacccacccctgaggtccaacgaccccaaatcacagaaccacccaggatggctgatg
cggggtctcaagccctggacccagtatgccatctttgtgaagaccctggtcaccttttcg
gatgaacgccggacctatggggccaagagtgacatcatttatgtccagacagatgccacc
aacccctctgtgcccctggatccaatctcagtgtctaactcatcatcccagattattttg
aagtggaaacccccctccgaccccaatggcaacatcacccactacctggttttctgggag
aggcaggcggaagacagtgagctgttcgagctggattattgcctcaaagggctgaagctg
ccctcgaggacctggtctccaccattcgagtctgaagattctcagaagcacaaccagagt
gagtatgaggattcggccggcgaatgctgctcctgtccaaagacagactctcagatcctg
aaggagctggaggagtcctcgtttaggaagacgtttgaggattacctgcacaacgtggtt
tttgtccccaggccatctcggaaacgcaggtcccttggcgatgttgggaatgtgacagcg
gctgtgcccacggtggcagctttccccaacacttcctcaaccagcgtgcccacgagtccg
gaggagcacaggccctttgagaaggtggtaaacaaggagtcgctggtcatctctggcttg
cgacacttcacaggctatcgcatcgagctgcaggcttgcaaccaagacacccctgaggaa
cggtgcagtgtggcagcctacgtcagtgccaggaccatgcctgaagccaaggctgatgac
atcgtcggccctgtgacgcacgaaatctttgagaacaacgttgtccacttgatgtggcag
gagccgaaggagcccaatggtctgatcgtgctgtatgaagtgagttatcggcgatatggc
gatgaggagctgcatctctgcgtctcccgcaagcacttcgctctggaacggggctgcagg
ctgcgtgggctgtcgccggggaactacagcgtgcgagtccgggccacctcccttgcgggc
aacggctcctggacggaacccacctatttctacgtgacagactatttagatgtcccgtca
aatattgcaaaaattatcatcggccccctcatctttgtctttctcttcagtgttgtgatt
ggaagtatttatctattcctgagaaagaggcagccagatgggccgctgggaccgctttac
gcttcttcaaaccctgagtatctcagtgccagtgatgtgtttccatgctctgtgtacgtg
ccggacgagtgggaggtgcctcgagagaagataaccctccttcgagagctggggcagggc
tccttcggcatggtatatgagggcaacgccagggacatcatcaagggtgaggcagagacc
cgtgtggcggtgaagacggtcaacgagtcagccagtctccgagagcggattgaattcctc
aatgaggcctcggtcatgaagggcttcacctgccatcacgtggtgcgcctcctgggagtg
gtgtccaagggccagcccacgctggtggtgatggagctgatggctcatggagacctgaag
agctacctccgttctctgcggccagaggctgagaataatcctggccgccctccgcctacc
ctgcaagagatgattcagatggcggcagagattgctgacgggatggcctacctgaacgcc
aagaagtttgtgcatcgggacctggcagcgagaaactgcatggtcgcccatgattttact
gtcaaaattggagactttggaatgaccagagacatctatgaaacggattactaccggaaa
gggggtaagggtctgctccctgtacggtggatggcgccggagtccctgaaggatggggtc
tttaccacttcttctgacatgtggtcctttggcgtggtcctttgggaaatcaccagcttg
gcagaacagccttaccaaggcctgtctaatgaacaggtgttgaaatttgtcatggatgga
gggtatctggatcaacccgacaactgtccagagagagtcactgacctcatgcgcatgtgc
tggcaattcaaccccaagatgaggccaaccttcctggagattgtcaacctgctcaaggac
gacctgcaccccagctttccggaggtgtcgttcttccacagcgaggagaacaaggctccc
gagagtgaggagctggagatggagtttgaggacatggagaatgtgcccctggaccgttcc
tcgcactgtcagagggaggaggcggggggccgggatggagggtcctcgctaggtttcaag
cggagctacgaggaacacatcccttacacacacatgaacggaggcaagaaaaacgggcgg
attctgaccttgcctcggtccaatccttcctaa

KEGG   Pongo abelii (Sumatran orangutan): 100451664
Entry
100451664         CDS       T01416                                 

Gene name
EPHA2
Definition
(RefSeq) ephrin type-A receptor 2
  KO
K05103  Eph receptor A2 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100451664 (EPHA2)
   04014 Ras signaling pathway
    100451664 (EPHA2)
   04015 Rap1 signaling pathway
    100451664 (EPHA2)
   04151 PI3K-Akt signaling pathway
    100451664 (EPHA2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100451664 (EPHA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100451664 (EPHA2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100451664 (EPHA2)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   100451664 (EPHA2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Pur_ac_phosph_N Interfer-bind Ephrin_rec_like SKG6 Pkinase_fungal
Other DBs
NCBI-GeneID: 100451664
NCBI-ProteinID: XP_024087413
LinkDB
Position
1
AA seq 976 aa
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVISG
VAVGVVLLLVLAGVGFFIHRRRKNLRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGTLKTSSGKKEVPVAIKTLKAGYTEKQRVDF
LGEAGIMGQFSHHNIIRLEGVVSKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML
RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI
NT seq 2931 nt   +upstreamnt  +downstreamnt
atggagctccaggcagcccgcgcctgcttcgccctgctgtggggctgtgcgctggccgcg
gccgcggcggcacagggcaaggaagtggtactgctggactttgctgcagctggaggggag
ctcggctggctcacacacccgtatggcaaagggtgggacctgatgcagaacatcatgaat
gacatgccgatctacatgtactccgtgtgcaacgtgatgtctggtgaccaggacaactgg
ctccgcaccaactgggtgtaccgaggagaggctgagcgtatcttcattgagctcaagttt
actgtacgtgactgcaacagcttccctggcggcgccagctcctgcaaggagactttcaac
ctctactatgccgagtcggacctggactatggcaccaacttccagaagcgcctgttcacc
aagattgacaccattgcgcccgatgagatcaccgtcagcagcgacttcgaggcacgccac
gtgaagctgaacgtggaggagcgctccgtggggccgctcacccgcaaaggcttctacctg
gccttccaggatatcggtgcctgtgtggcgctgctctccgtccgtgtctactacaagaag
tgccccgagctgctgcagggcctggcccacttccctgagaccatcgccggctctgatgca
ccctccctggccactgtggccggcacctgtgtggaccatgccgtggtgccaccgggcggt
gaagagccccgtatgcactgtgcagtggacggcgagtggctggtgcccattgggcagtgc
ctgtgccaggcaggctacgagaaggtggaggatgcctgccaggcctgctctcctggattc
tttaagtttgaggcatctgagagcccctgcttggagtgccctgagcacacgctgccatcc
cctgagggtgccacctcctgcgagtgtgaggaaggcttcttccgggcacctcaggaccca
gcgtcgatgccttgcacacgacccccctccgccccacactacctcacggccgtgggcatg
ggtgccaaggtggagctgcgctggacgccccctcaggacagcggaggccgcgaggacatt
gtctacagcgtcacctgtgaacagtgctggcccgagtctggggagtgcgggccgtgtgag
gccagtgtgcgctactcggagcctccgcacggattgacccgaaccagtgtgacagtcagc
gacctggagccccacatgaactacacctttaccgtggaggcccgcaatggcgtctcaggc
ctggtgaccagccgcagcttccgtactgccagtgtcagcatcaaccagacagagcccccc
aaggtgaggctggagggccgcagcaccacctctcttagcgtctcctggagcatccccccg
ccgcagcagagccgcgtgtggaagtacgaggtcacctaccgcaagaagggagactccaac
agctacaacgtgcgccgcactgagggtttctccgtgaccctggatgacctggctccggac
accacctacctggtccaggtgcaggcactgacgcaggagggccagggggccggcagcaag
gtgcacgaattccagacgctgtccccggagggatctggcaacttggcggtgattagcggc
gtggctgtcggtgtggtcctgcttctggtgctggcaggagttggcttctttatccaccgc
aggaggaagaacctgcgtgcccgccagtccccagaggacgtttacttctccaagtcagaa
caactgaagcccctgaagacatacgtggacccccacacatatgaggaccccaaccaggct
gtgttgaagttcactaccgagatccatccatcctgtgtcactcggcagaaggtgattgga
gcaggagagtttggggaggtgtacaagggcacgctgaagacatcctcggggaagaaggag
gtgccggtggccatcaagacgctgaaagccggctacacagaaaagcagcgagtggacttc
cttggcgaggccggcatcatgggccagttcagccaccacaacatcattcgcctggagggc
gtcgtctccaaatacaagcccatgatgatcatcactgagtacatggagaatggggccctg
gacaagttccttcgggagaaggatggtgagttcagcgtgctgcagctggtgggcatgctg
cggggcattgcagctggcatgaagtacctggccaacatgaactatgtgcaccgtgacctg
gctgcccgcaacatcctcgtcaacagcaacctggtctgcaaggtgtctgactttggcctg
tcccgcgtgctggaggacgaccccgaggccacctacaccaccagtggcggcaagatcccc
atccgctggaccgccccagaggccatttcctaccgcaagttcacctctgccagcgacgtg
tggagctttggcattgtcatgtgggaggtgatgacctacggcgagcggccctactgggag
ctgtccaaccacgaggtgatgaaagccatcaatgatggcttccggctccccacgcccatg
gactgcccctccgccatctaccagctcatgatgcagtgctggcagcaggagcgtgcccgc
cgccccaagttcgctgacatcgtcagcatcctggacaagctcattcgtgcccctgactcc
ctcaagaccctggctgacttcgacccccgggtgtctatccggctccccagcacgagcggc
tcagagggggtgcctttccgcacggtgtccgagtggctggagtccatcaagatgcagcag
tatacggagcacttcatggcggccggctacactgccatcgagaaggtggtgcagatgacc
aacgacgacatcaagaggattggggtgcggctgcccggccaccagaagcgcatcgcctac
agcctgctgggactcaaggaccaggtgaacactgtgggaatccccatctga

KEGG   Pongo abelii (Sumatran orangutan): 100452269
Entry
100452269         CDS       T01416                                 

Gene name
NTRK1
Definition
(RefSeq) high affinity nerve growth factor receptor isoform X2
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04722  Neurotrophin signaling pathway
pon04750  Inflammatory mediator regulation of TRP channels
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05216  Thyroid cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100452269 (NTRK1)
   04014 Ras signaling pathway
    100452269 (NTRK1)
   04020 Calcium signaling pathway
    100452269 (NTRK1)
   04151 PI3K-Akt signaling pathway
    100452269 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100452269 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100452269 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100452269 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452269 (NTRK1)
   05202 Transcriptional misregulation in cancer
    100452269 (NTRK1)
   05230 Central carbon metabolism in cancer
    100452269 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100452269 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100452269 (NTRK1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100452269 (NTRK1)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   100452269 (NTRK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TPKR_C2 I-set LRR_8 TrkA_TMD Ig_3 Ig_2 LRR_4
Other DBs
NCBI-GeneID: 100452269
NCBI-ProteinID: XP_002810050
Ensembl: ENSPPYG00000000698
UniProt: H2N5B2
LinkDB
Position
1
AA seq 796 aa
MLRGGRRGQLGWHSWAEGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPSAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GHLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEVSESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgctgcgaggaggacggcgcgggcagcttggctggcacagctgggctgaggggccgggc
agcctgctggcttggctgatactggcatctgcgggcgccgcaccctgccccgatgcctgc
tgcccccacggctcctcgggactgcgatgcacccgggatggggccctggatagcctccac
cacctgcccagcgcagagaacctgactgagctctacatcgagaaccagcagcatctgcag
catctggagctccgtgacctgaggggcctgggggagctgagaaacctcaccatcgtgaag
agtggtctccgtttcgtggcgccagacgccttccatttcactcctcggctcagtcgcctg
aatctctccttcaacgctctggagtctctctcctggaaaactgtgcagggcctctcctta
caggaactggtcctgtcggggaaccctctgcactgttcctgtgccctgcgctggctacag
cgctgggaggaggagggactgggcggagtgcctgaacagaagctgcagtgtcacgggcaa
gggcacctggcccatatgcccaatgccagctgtggtgtgcccacgctgaaggtccaggtg
cccaatgcctcggtggatgtgggggacgacgtgctgctgcggtgccaggtggaggggcgg
ggcctggagcaggccggctggatcctcacggagctggagcagtcagccacagtgatgaaa
tctgggggtctgccatccctggggctgaccctggccaatgtcaccagtgacctcaacagg
aagaatgtgacgtgctgggcagagaacgatgtgggccgggcagaggtctctgttcaggtc
aacgtctccttcccggccagtgtgcagctgcacacagcggtggagatgcaccactggtgc
atccccttctctgtggatgggcagccggcaccatctctgcgctggctcttcaatggctcc
gtgctcaatgagaccagcttcatcttcaccgagttcctggagccggcggccaatgagacc
gtgcggcacgggtgtctgcgcctcaaccagcccacccacgtcaacaacggcaactacacg
ctgctggctgccaaccccttcggccaggcctccgcctccatcatggctgccttcatggac
aaccctttcgagttcaaccccgaggaccccatccctgtctccttctcgccagtggacact
aacagcacatctggagacccggtggagaagaaggacgaaacaccttttggggtctcggtg
gctgtgggcctggccgtctttgcctgcctcttcctttctacgctgctccttgtgctcaac
aaatgcggacggagaaacaagtttgggatcaaccgcccggctgtgctggctccagaggac
gggctggccatgtccctgcatttcatgacattgggtggcagctccctgtcccccaccgag
ggcaaaggctctgggctccaaggccacatcatcgagaacccacaatacttcagtgatgcc
tgtgttcaccacatcaagcgccgggacatcgtgctcaagtgggagctgggggagggcgcc
tttgggaaggtcttccttgctgagtgccacaacctcctgcctgagcaggacaagatgctg
gtggctgtcaaggcattgaaggaggtgtccgagagtgctcggcaggacttccagcgtgag
gctgagctgctcaccatgctgcagcaccagcacattgtgcgcttcttcggcgtctgcacc
gagggccgccccctgctcatggtctttgagtatatgcggcatggggacctcaaccgcttc
ctccgatcccatgggcctgatgccaagctgctggctggtggggaggatgtggctccaggc
cccctgggtctggggcagctgctggccgtggctagccaggtcgctgcggggatggtgtac
ctggcgggtctgcattttgtgcaccgggacctggccacacgcaactgtctggtgggccag
ggactggtggtcaagattggtgattttggcatgagcagggatatctacagcaccgactat
taccgtgtgggaggccgcaccatgctgcccattcgctggatgccgcccgagagcatcctg
taccgcaagttcaccaccgagagcgacgtgtggagcttcggcgtggtcctctgggagatc
ttcacctacggcaagcagccctggtaccagctctccaacacggaggcaatcgactgcatc
acgcagggacgtgagttggagcggccacgtgcctgcccaccagaggtctacgccatcatg
cggggctgctggcagcgggagccccagcaacgccacagcatcaaggatgtgcacgcccgg
ctgcaagccctggcccaggcacctcctgtctacctggatgtcctgggctag

KEGG   Pongo abelii (Sumatran orangutan): 100454731
Entry
100454731         CDS       T01416                                 

Gene name
FLT3
Definition
(RefSeq) receptor-type tyrosine-protein kinase FLT3 isoform X1
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05221  Acute myeloid leukemia
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100454731 (FLT3)
   04014 Ras signaling pathway
    100454731 (FLT3)
   04151 PI3K-Akt signaling pathway
    100454731 (FLT3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100454731 (FLT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454731 (FLT3)
   05202 Transcriptional misregulation in cancer
    100454731 (FLT3)
   05230 Central carbon metabolism in cancer
    100454731 (FLT3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100454731 (FLT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100454731 (FLT3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100454731 (FLT3)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100454731 (FLT3)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100454731 (FLT3)
CD molecules [BR:pon04090]
 Proteins
  100454731 (FLT3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig I-set Ig_3 Ig_2 APH
Other DBs
NCBI-GeneID: 100454731
NCBI-ProteinID: XP_024086677
Ensembl: ENSPPYG00000005244
LinkDB
Position
13
AA seq 993 aa
MPALARGGGRLPLLVVLSAIIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSAGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDDGYSISKFCNHKHQPGEYIFHA
ENDDAQLTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITQ
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIDYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQACWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSERPHTYQNRRPFSREMDSGPLSPQTQVEDS
NT seq 2982 nt   +upstreamnt  +downstreamnt
atgccggcgttggcgcgcggcggcggccggctgccgctgctcgttgttttgtctgcaatc
atatttgggactattacaaatcaagatctgcctgtgatcaagtgtgttttaatcaatcat
aagaacaatgattcatcagtggggaagtcatcatcatatcccatggtgtcagaatcccca
gaagacctcgggtgtgcattgagaccccagagcgcagggacagtgtacgaagctgccgct
gtggaagtggatgtatctgcttccatcacattgcaagtgctggttgacgccccagggaac
atttcctgtctctgggtctttaagcacagctccctgaattgccagccacattttgattta
caaaacagaggagttgtttccatggtcattttgaaaatgacagaaacccaagctggagaa
tacctactttttattcagagtgaagctaccaattacacaatattgtttacagtgagtata
agaaataccctgctttacacattaagaagaccttactttagaaaaatggaaaaccaggac
gccctggtctgcatatctgagagcgttccagagccgatcgtggaatgggtgctttgcgat
tcacagggggaaagctgtaaagaagaaagtccagctgttgttaaaaaggaggaaaaagtg
cttcatgaattatttgggacggacataaggtgctgtgccagaaatgaactgggcagggaa
tgcaccaggctcttcacaatagatctaaatcaaactcctcagaccacattgccacaatta
tttcttaaagtaggggaacccttatggataaggtgcaaagctgttcatgtgaaccatgga
ttcgggctcacctgggaattagaaaacaaagcactcgaggagggcaactactttgagatg
agtacctattcaacaaacagaactatgatacggattctgtttgcttttgtatcatcagtg
gcaagaaacgacaccggatactacacttgttcctcttcaaagcatcccagtcaatcagct
ttggttaccatcgtagaaaagggatttataaatgctaccaattcaagtgaagattatgaa
attgaccaatatgaagagttttgtttttctgtcaggtttaaagcctacccacaaatcaga
tgtacgtggaccttctctcgaaaatcatttccttgtgagcaaaagggtctcgatgacgga
tacagcatatccaagttttgcaatcataagcaccagccaggagaatatatattccatgca
gaaaatgatgatgcccaattgaccaaaatgttcacgctgaatataagaaggaaacctcaa
gtgctcgcagaagcatcagcaagtcaggcgtcctgtttctcggatggatacccattacca
tcttggacctggaagaagtgttcagacaagtctcccaactgcacagaagagatcacacaa
ggagtctggaatagaaaggctaacagaaaagtatttggacagtgggtgtcgagcagtact
ctaaacatgagtgaagccataaaagggttcctggtcaagtgctgtgcatacaattccctt
ggcacatcttgtgagacgatccttttaaactctccaggccccttccctttcatccaagac
aacatctcattctatgcaacaattggtgtttgtctcctcttcattgtcgttttaaccctg
ctaatttgtcacaagtacaaaaagcaatttaggtatgaaagccagctacagatggtacag
gtgaccggctcctcagataatgagtacttctacgttgatttcagagaatatgaatatgat
ctcaaatgggagtttccaagagaaaatttagagtttgggaaggtactaggatcaggtgct
tttggaaaagtgatgaacgcaacagcttatggaattagcaaaacaggagtctcaatccag
gttgccgtcaaaatgctgaaagaaaaagcagacagctctgaaagagaggcactcatgtca
gaactcaagatgatgacccagctgggaagccacgagaatattgtgaatctgctgggggcg
tgcacactgtcaggaccaatttacttgatttttgaatactgttgctatggtgatcttctc
aactatctaagaagtaaaagagaaaaatttcacaggacttggacagagattttcaaggaa
cacaatttcagtttttaccccactttccaatcacatccaaattccagcatgcctggttca
agagaagttcagatacacccggactcggatcaaatctcagggcttcatgggaattcattt
cactctgaagatgaaattgattatgaaaaccaaaaaaggctggaagaagaggaagacttg
aatgtgcttacatttgaagatcttctttgctttgcatatcaagttgccaaaggaatggaa
tttctggaatttaagtcgtgtgttcacagagacctggccgccaggaacgtgctcgtcacc
cacgggaaggtggtgaagatatgtgactttggattggctcgagatatcatgagtgattcc
aactatgttgtcaggggcaatgcccgtctgcctgtaaaatggatggcccctgaaagcctg
tttgaaggcatctacaccattaagagtgatgtctggtcatacggaatattactgtgggaa
atattctcacttggtgtgaatccttaccctggcattccggttgatgctaacttctacaaa
ctgattcaaaatggatttaaaatggatcagccattttatgctacagaagaaatatacatt
ataatgcaagcctgctgggcttttgactcaaggaaacggccatccttccctaatttgact
tcatttttaggatgtcagctggcagatgcagaagaagcgatgtatcagaatgtggatggt
cgtgtttcggaacgtcctcacacctaccaaaacaggcgacctttcagcagagagatggat
tcggggccactctctccgcagactcaggtcgaagattcctag

KEGG   Pongo abelii (Sumatran orangutan): 100456038
Entry
100456038         CDS       T01416                                 

Gene name
NGFR
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 16
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04215  Apoptosis - multiple species
pon04722  Neurotrophin signaling pathway
pon05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100456038 (NGFR)
   04014 Ras signaling pathway
    100456038 (NGFR)
   04015 Rap1 signaling pathway
    100456038 (NGFR)
   04151 PI3K-Akt signaling pathway
    100456038 (NGFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100456038 (NGFR)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100456038 (NGFR)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100456038 (NGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100456038 (NGFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100456038 (NGFR)
   04090 CD molecules [BR:pon04090]
    100456038 (NGFR)
Cytokine receptors [BR:pon04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100456038 (NGFR)
CD molecules [BR:pon04090]
 Proteins
  100456038 (NGFR)
SSDB
Motif
Pfam: TNFR_16_TM TNFR_c6 Death TPR_21
Other DBs
NCBI-GeneID: 100456038
NCBI-ProteinID: XP_024091423
LinkDB
Position
17
AA seq 427 aa
MEAGATGLAMDGPRLLLLLLLGVSLGGAKEACPTSLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVADVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaggcaggtgccaccggcctcgccatggacgggccgcgcctgctgctgttgctgctt
ctgggggtgtcccttggaggtgccaaggaggcatgccccacaagcctgtacacacacagc
ggcgagtgctgcaaagcctgcaacctgggcgagggtgtggcccagccttgtggagccaac
cagaccgtgtgtgagccctgcctggacagcgtgacgttctccgacgtggtgagcgcaacc
gagccgtgcaagccgtgcaccgagtgcgtggggcttcagagcatgtcggcgccgtgcgtg
gaggccgacgacgccgtgtgccgctgcgcctacggctactaccaggatgagacgactggg
cgctgcgaggcgtgccgcgtgtgcgaggcgggctcgggcctcgtgttctcgtgccaagac
aagcagaacaccgtgtgcgaggagtgccccgacggcacgtattccgacgaggccaaccac
gtggacccgtgcctgccctgcaccgtgtgcgaggacaccgagcgccagctccgcgagtgc
acacgctgggccgacgccgagtgcgaggagatccctggccgttggattacacggtccaca
cccccggagggctcggacagcacagcccccagcacccaggagcctgaggcacctccagaa
caagacctcatagccagcacggtggcagatgtggtgaccacagtgatgggcagctcccag
cctgtggtgacccgaggcaccaccgacaacctcatccctgtctattgctccatcctggct
gctgtggttgtgggccttgtggcctacatagccttcaagaggtggaacagctgcaagcaa
aacaagcaaggagccaacagccggccagtgaaccagacgcccccaccagagggagaaaaa
ctccacagcgacagtggcatctccgtggacagccagagcctgcatgaccagcagccccat
acgcagacagcctcgggccaggccctcaagggtgacggaggcctctacagcagcctgccc
ccagccaagcgggaggaggtggagaagcttctcaacggctctgcaggggacacctggcgg
cacctggcgggcgaactgggctaccagcccgagcacatagactcctttacccatgaggcc
tgccccgttcgtgccctgcttgcaagctgggccacccaggacagcgccacactggacgcc
ctcctggccgccctgcgccgcatccagcgagccgaccttgtggagagtctgtgcagtgag
tccactgccacgtccccggtgtga

KEGG   Pongo abelii (Sumatran orangutan): 100456061
Entry
100456061         CDS       T01416                                 

Gene name
FLT1
Definition
(RefSeq) vascular endothelial growth factor receptor 1 isoform X1
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon05202  Transcriptional misregulation in cancer
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100456061 (FLT1)
   04014 Ras signaling pathway
    100456061 (FLT1)
   04015 Rap1 signaling pathway
    100456061 (FLT1)
   04066 HIF-1 signaling pathway
    100456061 (FLT1)
   04020 Calcium signaling pathway
    100456061 (FLT1)
   04151 PI3K-Akt signaling pathway
    100456061 (FLT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100456061 (FLT1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100456061 (FLT1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100456061 (FLT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100456061 (FLT1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100456061 (FLT1)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   100456061 (FLT1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase ig Ig_2 V-set VEGFR-2_TMD Ig_6 Ig_4 C1-set Ig_5 Herpes_gE Adeno_E3_CR1 Marek_A
Other DBs
NCBI-GeneID: 100456061
NCBI-ProteinID: XP_024086675
Ensembl: ENSPPYG00000005246
LinkDB
Position
13
AA seq 1338 aa
MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHVMQAGQTLHLQCRGEAAHK
WSLPETVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD
GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
VQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKHQVLETVAGKRSYRLSMKVK
AFPSPEVVWLKEGLPATEKSARYLTRGYSLIIKDLTEEDAGNYTILLSIKQSNVFKNLTA
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC
DFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKTASTLVVADSRISGIYICIASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDITWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLEDSGTYACRARNVYTGEEILQKKEITIRDQEA
PYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER
VTEDDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI
RKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK
VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSV
TSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKEGISA
PKFNSGSSDDVRYVNAFKFMSLERIKTVEELLPNATSMFDDYQGDSSTLLASPMLKRFTW
TDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHISEGKRRFTYDNAELERKIAC
CSPPPDYNSVVLYSTPPI
NT seq 4017 nt   +upstreamnt  +downstreamnt
atggtcagctactgggacaccggggtcctgctgtgcgcgctgctcagctgtttgcttctc
acaggatctagttcaggttcaaaattaaaagatcctgaactgagtttaaaaggcacccag
cacgtcatgcaagcaggccagacactgcatctccaatgcaggggggaagcagcccataaa
tggtctttgcctgaaacggtgagtaaggaaagcgaaaggctgagcataactaaatctgcc
tgtggaagaaatggcaaacaattctgcagtactttaaccttgaacacagctcaagcaaac
cacactggcttctacagctgcaaatatctagctgtacctacttcaaagaagaaggaaaca
gaatctgcaatctatatatttattagtgatacaggtagacctttcgtagagatgtacagt
gaaatccccgaaattatacacatgactgaaggaagggagctcgtcattccctgccgggtt
acgtcacctaacatcactgttactttaaaaaagtttccacttgacactttgatccctgat
ggaaaacgcatcatctgggacagtagaaagggcttcatcatatcaaatgcaacgtacaaa
gaaatagggcttctgacctgtgaagcaacagtcaatgggcatttgtataagacaaactat
ctcacacatcgacaaaccaatacaatcatagatgtccaaataagcacaccacgcccagtc
aaattacttagaggccatactcttgtcctcaattgtactgctaccactcccttgaacacg
agagttcaaatgacctggagttaccctgatgaaaaaaataagagagcttctgtaaggcga
cgaattgaccaaagcaattcccatgccaacatattctacagtgttcttactattgacaaa
gtgcagaacaaagacaaaggactttatacttgtcgtgtaaggagtggaccatcattcaaa
tctgttaacacctcagtgcatatatatgataaagcattcatcactgtgaaacatcgaaaa
catcaggtgctcgaaaccgtagctggcaagcggtcttaccggctctctatgaaagtgaag
gcatttccctcgccggaagttgtatggttaaaagaggggttacctgcaactgagaaatct
gctcgctatttgactcgtggctactcgttaattatcaaggacttaactgaagaggatgca
gggaattatacaatcttgctgagcataaaacagtcaaatgtgttcaaaaacctcactgcc
actctaattgtcaatgtgaaaccccagatttacgaaaaggccgtgtcatcgtttccagac
ccagctctctacccactgggcagcagacaaatcctgacttgtaccgcatatggtatccct
caacctacaatcaagtggttctggcacccctgtaaccataatcattccgaagcaaggtgt
gacttttgttccaataatgaagagtcctttatcctggatgctgacagcaacatgggaaac
agaattgagagcatcactcagcgcatggcaataatagaaggaaagaataagacggctagc
accttggttgtggctgactctagaatttctggaatctacatttgcatagcttccaataaa
gttgggactgtgggaagaaacataagcttttatatcacagatgtgccaaatgggtttcat
gttaacttggaaaaaatgccgacggaaggagaggacctgaaactgtcttgcacagttaac
aagttcttatacagagacatcacttggattttactgcgcacagttaataacagaacaatg
cactacagtattagcaagcaaaaaatggccatcactaaggagcactccatcactcttaat
cttaccatcatgaatgtttccctggaagattcaggcacctatgcctgcagagccaggaat
gtatacacaggggaagaaatcctccagaagaaagaaattacaatcagagatcaggaagca
ccatacctcctgcgaaacctcagtgatcacacagtggccatcagcagttctaccacttta
gactgtcatgctaatggtgtccccgagcctcagatcacttggtttaaaaacaaccacaaa
atacaacaagagcctggaattattttaggaccaggaagcagcacgctgtttattgaaaga
gtcacagaagatgatgaaggtgtctatcactgcaaagccaccaaccagaagggctctgtg
gaaagttcagcatacctcactgttcaaggaacctcggacaagtctaatctggagctgatc
actctaacatgcacctgtgtggctgcgactctcttctggctgctattaaccctctttatc
cgaaaaatgaaaaggtcttcttctgaaataaagactgactacctatcaattataatggac
ccagatgaagttcccttggatgagcagtgtgagcggctcccttatgatgccagcaagtgg
gagtttgcccgggagagacttaaactgggcaaatcacttggaagaggggcttttggaaaa
gtggttcaagcatcagcatttggcattaagaaatcacctacgtgccggactgtggctgtg
aaaatgctgaaagagggggccacggccagcgagtacaaagctctgatgactgagctcaaa
atcttgacccacattggccaccatctgaacgtggttaacctgctgggagcctgcaccaag
caaggagggcctctgatggtgattgttgaatactgcaaatatggaaatctctccaactac
ctcaagagcaaacgtgacttattttttctcaacaaggatgcagcattacacatggagcct
aagaaagaaaaaatggagccaggcctggaacaaggcaagaaaccaagactagatagcgtc
accagcagcgagagctttgcgagctccgggtttcaggaagataaaagtctgagtgatgtt
gaggaagaggaggattctgacggtttctacaaggagcccatcactatggaagatctgatt
tcttacagttttcaagtggccagaggcatggagttcctgtcttctagaaagtgcattcat
cgggacctggcagcgagaaacattcttttatctgagaacaacgtggtgaagatttgtgat
tttggcctcgcccgggatatttataagaaccccgattatgtgagaaaaggagatactcga
cttcctctgaaatggatggctcctgaatctatctttgacaaaatctacagcaccaagagc
gacgtgtggtcttacggagtattgctgtgggaaatcttctccttaggtgggtctccatac
ccaggagtacaaatggatgaggacttttgcagtcgcctgagggaaggcatgaggatgaga
gctcctgagtactctactcctgaaatctatcagatcatgctggactgctggcacagagac
ccaaaagaaaggccaagatttgcagaacttgtggaaaaactaggtgatttgcttcaagca
aatgtacaacaggatggtaaagactacatcccaatcaatgccatactgacaggaaatagt
gggtttacatactcaactcctgccttctctgaggacttcttcaaggaaggtatttcagct
ccgaagtttaattcaggaagctctgatgatgtcagatatgtaaatgctttcaagttcatg
agcctggaaagaatcaaaaccgttgaagaacttttaccaaatgccacctccatgtttgat
gactaccagggggacagcagcactctgttggcctctcccatgctgaagcgcttcacctgg
actgacagcaaacccaaggcctcgctcaagattgacttgagagtaaccagtaagagtaag
gagtcggggctatctgatgtcagcaggcccagtttctgccattccagctgtgggcacatc
agcgaaggcaagcgcaggttcacctacgacaacgctgagctggaaaggaaaatcgcgtgc
tgctccccacccccagactacaactcggtggtcctgtactccaccccacccatctag

KEGG   Pongo abelii (Sumatran orangutan): 100459280
Entry
100459280         CDS       T01416                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X2
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon05160  Hepatitis C
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459280 (EGFR)
   04012 ErbB signaling pathway
    100459280 (EGFR)
   04014 Ras signaling pathway
    100459280 (EGFR)
   04015 Rap1 signaling pathway
    100459280 (EGFR)
   04630 JAK-STAT signaling pathway
    100459280 (EGFR)
   04066 HIF-1 signaling pathway
    100459280 (EGFR)
   04068 FoxO signaling pathway
    100459280 (EGFR)
   04020 Calcium signaling pathway
    100459280 (EGFR)
   04072 Phospholipase D signaling pathway
    100459280 (EGFR)
   04151 PI3K-Akt signaling pathway
    100459280 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100459280 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100459280 (EGFR)
   04520 Adherens junction
    100459280 (EGFR)
   04540 Gap junction
    100459280 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459280 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100459280 (EGFR)
   04915 Estrogen signaling pathway
    100459280 (EGFR)
   04921 Oxytocin signaling pathway
    100459280 (EGFR)
   04926 Relaxin signaling pathway
    100459280 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100459280 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459280 (EGFR)
   05206 MicroRNAs in cancer
    100459280 (EGFR)
   05205 Proteoglycans in cancer
    100459280 (EGFR)
   05230 Central carbon metabolism in cancer
    100459280 (EGFR)
   05231 Choline metabolism in cancer
    100459280 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100459280 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100459280 (EGFR)
   05212 Pancreatic cancer
    100459280 (EGFR)
   05225 Hepatocellular carcinoma
    100459280 (EGFR)
   05226 Gastric cancer
    100459280 (EGFR)
   05214 Glioma
    100459280 (EGFR)
   05218 Melanoma
    100459280 (EGFR)
   05219 Bladder cancer
    100459280 (EGFR)
   05215 Prostate cancer
    100459280 (EGFR)
   05213 Endometrial cancer
    100459280 (EGFR)
   05224 Breast cancer
    100459280 (EGFR)
   05223 Non-small cell lung cancer
    100459280 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100459280 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100459280 (EGFR)
   05171 Coronavirus disease - COVID-19
    100459280 (EGFR)
   05163 Human cytomegalovirus infection
    100459280 (EGFR)
   05165 Human papillomavirus infection
    100459280 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100459280 (EGFR)
   01522 Endocrine resistance
    100459280 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100459280 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100459280 (EGFR)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100459280 (EGFR)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100459280 (EGFR)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100459280 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100459280 (EGFR)
  Exosomal proteins of bladder cancer cells
   100459280 (EGFR)
SSDB
Motif
Pfam: Recep_L_domain GF_recep_IV Furin-like
Other DBs
NCBI-GeneID: 100459280
NCBI-ProteinID: XP_002817983
LinkDB
Position
7
AA seq 628 aa
MRSSRTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGS
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgcgatcctcccggacggccggggcagcgctcctggcgctgctagctgcgctctgcccg
gcgagtcgggctctggaggaaaagaaagtttgccaaggcacgagtaacaagctcacgcag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatctggaaattacctatgtacagaggaattatgatctttccttcttaaag
accatccaggaggtggctggttatgtcctcatcgccctcaacacagtggagcggattcct
ttggaaaacctgcagatcatcagaggaaatatgtactatgaaaattcctatgccttagca
gtcttatctaactatgatgcaaataaaaccggactaaaggagctgcccatgagaaattta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagcgactttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaagctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctct
gggcgctgccgcggcaaatcccccagtgactgctgccacaaccagtgtgccgctggctgc
acgggcccccgggagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctctacaaccccaccacataccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgtggggccgacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaacggaata
ggtattggtgaatttaaagacacactctccataaatgctacgaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacacactccacctctggatccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggacctccatgctttt
gagaacctagaaatcatacgcggcaggaccaagcaacatgggcagttttctcttgcagtc
gtcagcctgaacataacatccttgggattacgctccctcaaggagataagcgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccggtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacaggccaggtctgccatgccttgtgctcccccgagggctgctggggcccggagccc
agggactgcgtctcctgccggaatgtcagccgaggcagagaatgcgtggacaagtgcaac
attctggagggcgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gaatgcctgccccaggccatgaacatcacctgcacgggacggggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccggcaggagtcatg
ggagaaaacaacaccctggtctggaagtacgcagacgccggccacgtgtgccacctgtgc
catccaaactgcacctacgggtcctaa

KEGG   Pongo abelii (Sumatran orangutan): 100460001
Entry
100460001         CDS       T01416                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100460001 (PDGFRB)
   04014 Ras signaling pathway
    100460001 (PDGFRB)
   04015 Rap1 signaling pathway
    100460001 (PDGFRB)
   04630 JAK-STAT signaling pathway
    100460001 (PDGFRB)
   04020 Calcium signaling pathway
    100460001 (PDGFRB)
   04072 Phospholipase D signaling pathway
    100460001 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    100460001 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100460001 (PDGFRB)
   04540 Gap junction
    100460001 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460001 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460001 (PDGFRB)
   05206 MicroRNAs in cancer
    100460001 (PDGFRB)
   05230 Central carbon metabolism in cancer
    100460001 (PDGFRB)
   05231 Choline metabolism in cancer
    100460001 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    100460001 (PDGFRB)
   05218 Melanoma
    100460001 (PDGFRB)
   05215 Prostate cancer
    100460001 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100460001 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100460001 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100460001 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100460001 (PDGFRB)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100460001 (PDGFRB)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100460001 (PDGFRB)
CD molecules [BR:pon04090]
 Proteins
  100460001 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set C1-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 100460001
NCBI-ProteinID: XP_002816120
Ensembl: ENSPPYG00000015943
UniProt: A0A663D6Y7 H2PH25
LinkDB
Position
5
AA seq 1106 aa
MRLLGAMPALALKGQLLLLPLLLLLEPQVSQGLVITPPGPELVLNVSSTFVLTCSGSAPV
VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLEPDERKRLYIFV
PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDIALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQV
EPEPELEQLPDSGCPAPRVEAEDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgcggcttctgggtgcgatgccagctctggccctcaaaggccagctgctgttgctgccc
ctcctgttactgctggaaccacaggtctctcagggcctggtcatcacacccccagggcca
gagcttgtcctcaatgtctccagcaccttcgttctgacctgctctggttcagctccggtg
gtgtgggaacggatgtcccaggagcccccacaggaaatggccaaggcccaggatggcacc
ttctccagcgtgctgacactgaccaacctcactgggctagacacgggagaatacttttgc
acccacaatgactcccgtggactggagcctgatgagcggaaacggctctacatctttgtg
ccagatcccactgtgggcttcctccctaatgatgccgaggaactattcatctttctcacg
gaaataactgagatcaccattccatgccgagtaacagacccacagctggtggtgacactg
cacgagaagaaaggggacattgcactgcctgtcccctatgatcaccaacgtggcttttct
ggtatctttgaggacagaagctacatctgcaaaaccaccattggggacagggaggtggat
tccgatgcctactatgtctacagactccaggtgtcatctatcaacgtctctgtgaacgca
gtgcagactgtggtccgccagggtgagaacatcaccctcatgtgcattgtgatcgggaat
gaggtggtcaacttcgagtggacatacccccgcaaagaaagtgggcggctggtggagccg
gtgaccgacttcctcttggatatgccttaccacatccgctccatcctgcacatccccagt
gccgagttagaagactcggggacctacacctgcaatgtgacggagagtgtgaatgaccat
caggatgaaaaggccatcaacatcaccgtggttgagagtggctacgtgcggctcctggga
gaagtgggcacactgcaatttgctgagctgcatcggagccggacactgcaggtagtattc
gaggcctacccaccgcccaccgtcctgtggtttaaagacaaccgcaccctgggcgactcc
agcgctggcgagatcgccctgtccacgcgcaacgtgtcggagacccggtatgtgtcagag
ctgacactggttcgcgtgaaggtggcagaggctggccactacaccatgcgggccttccat
gaggacgctgaggtccagctctccttccagctacagatcaatgtccctgtccgagtgctg
gagctaagtgagagccaccctgacagcggggaacagacagtccgctgtcgtggccggggc
atgccccagccgaacatcatctggtccgcctgcagagacctcaaaaggtgtccacgcgag
ctgccgcccacgctgctggggaacagttccgaagaggagagccagctggagacgaacgtg
acgtactgggaggaggagcaggagtttgaggtggtgagcacactgcgtctgcagcacgtg
gatcggccgctgtcggtgcgctgcacgctgcgcaacgctgtgggccaggacacgcaggag
gtcatcgtggtgccacactccttgccctttaaggtggtggtgatctcagccatcctggcc
ctggtggtgctcaccatcatctcccttatcatcctcatcatgctttggcagaagaagcca
cgttacgagatccgatggaaggtgattgagtctgtgagctctgacggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacgtgggagctgccgcgggaccagctt
gtgctgggacgcaccctcggctctggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggccacgatgaaagtggccgtcaagatgcttaaatccacagcc
cgcagcagtgagaagcaagcccttatgtcggagctgaagatcatgagtcaccttgggccc
cacctgaacgtggtcaacctgttgggggcctgcaccaaaggaggacccatctatatcatc
actgagtactgccgctacggagacctggtggactacctgcaccgcaacaaacacaccttc
ctgcagcaccactctgacaagcgccgcccgcccagcgcggagctctacagcaatgcactg
cccgttgggctccccctgcccagccatgtgtccttgactggggagagcgacggtggctac
atggacatgagcaaggacgagtcggtggactacgtacccatgctggacatgaaaggagac
gtcaaatatgcagacatcgagtcctccaattacatggccccttacgataactacgttccc
tctgcccctgagaggacctgtcgggcaactttgatcaacgagtctccagtgctaagctac
atggacctcgtgggcttcagctaccaggtggccaatggcatggagtttctggcctccaag
aactgcgtccacagagacctggcggctaggaacgtgctcatctgtgaaggcaagctggtc
aagatctgtgactttggcctggctcgagacatcatgcgggactcgaattacatctccaaa
ggcagcacctttttgcctttgaagtggatggctccggagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcaccttgggt
ggcaccccttacccagagctgcccatgaatgaacagttctacaatgccatcaaacggggt
taccgcatggcccagcctgcccatgcctccgatgagatctatgagatcatgcagaagtgc
tgggaagagaagtttgagattcggccccccttctcccagctggtgctgcttctcgagaga
ctgttgggcgaaggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagt
gaccacccagccatccttcggtcccaggcccgcttgcctgggttccatggcctccgatct
cccctggacaccagctccgtcctctatactgccgtgcagcccaatgagggtgacaacgac
tatatcatccccctgcccgaccccaaacccgaggttgctgacgagggcccactggagggt
tcccccagcctagccagctccaccctgaatgaagtcaacacctcctcaaccatctcctgt
gacagccccctggagccccaggatgaaccagagccagagccccagcttgagctccaggtg
gagccagagccggagctggaacagctgccggattcagggtgccctgcgcctcgggtggaa
gcagaggacagcttcctgtag

KEGG   Pongo abelii (Sumatran orangutan): 100461105
Entry
100461105         CDS       T01416                                 

Gene name
FGFR4
Definition
(RefSeq) fibroblast growth factor receptor 4 isoform X1
  KO
K05095  fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100461105 (FGFR4)
   04014 Ras signaling pathway
    100461105 (FGFR4)
   04015 Rap1 signaling pathway
    100461105 (FGFR4)
   04020 Calcium signaling pathway
    100461105 (FGFR4)
   04151 PI3K-Akt signaling pathway
    100461105 (FGFR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100461105 (FGFR4)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100461105 (FGFR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100461105 (FGFR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461105 (FGFR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100461105 (FGFR4)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100461105 (FGFR4)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100461105 (FGFR4)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100461105 (FGFR4)
CD molecules [BR:pon04090]
 Proteins
  100461105 (FGFR4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig V-set C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 100461105
NCBI-ProteinID: XP_024103320
Ensembl: ENSPPYG00000016083
LinkDB
Position
5
AA seq 802 aa
MWLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLSEDAGRYLCLARGSMIVLQNLTLIIDDS
LTSSNDDKDPKSHMDSSNRHIYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPMP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHDRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS
VFSHDPLPLGSSSFPFGSGVQT
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgtggctgctgctggccctgttgggggtcctgctgagtgtgcctgggcctccagtcttg
tccctggaggcctctgaggaagtggagctggagccctgcctggctcccagcctggagcag
caagagcaggagctgacagtagcccttgggcagcctgtgcggctgtgctgtgggcgggct
gagcgtggtggccactggtacaaggagggcagtcgcctggcacctgccggccgtgtacgg
ggctggaggggccgcctagagattgccagcttcctatctgaggatgctggccgctacctc
tgcctggcacgaggctccatgatcgtcctgcagaatctcaccttgattatagatgactcc
ttgacctccagcaacgatgataaggaccccaagtcccatatggactcctcgaataggcac
atttacccccagcaagcaccttactggacacacccccagcgcatggagaagaaactgcat
gcagtacctgcggggaacaccgtcaagttccgctgtccagctgcaggcaaccccatgccc
accatccgctggcttaaggatggacaggcctttcatggggagaaccgcattggaggcatt
cggctgcgccatcagcactggagtctcgtgatggagagcgtggtaccctcggaccgcggc
acgtacacctgcctggtagagaatgctgtgggcagcatccgctataactacctgctagat
gtgctggagcggtccccgcaccggcccatcctgcaggccgggctcccggccaacaccaca
gccgtggtgggcagtgacgtggagctgctgtgtaaggtgtacagcgatgcccagccccac
atccagtggctgaagcacatcgtcatcaacggcagcagcttcggagccgacggtttcccc
tatgtgcaagtcctaaagactgcagacatcaatagctcagaggtggaggtcctgtacctg
cggaacgtgtcagccgaggatgcaggcgagtacacctgcctcgcaggcaattccatcggc
ctctcctaccagtctgcctggctcacggtgctgccagaggaggaccccacatggaccgca
gcagcgcccgaggccaggtatacggacatcatcctgtacgcgtcgggctccctggccttg
gctgtgctcctactgctggccgggctgtatcgagggcaggcgctccacgaccggcacccc
cgcccgcccgccactgtgcagaagctctcccgcttccctctggcccgacagttctccctg
gagtcaggctcttccggcaagtcaagctcatccctagtacgaggcgtgcgtctctcctcc
agcggccccgccttgctcgccggcctcgtgagtctagatctacctctcgacccactatgg
gagttcccccgggacaggctggtgcttggaaagcccctgggcgagggctgctttggccag
gtagtacgtgcagaggcctttggcatggaccctgcccggcctgaccaagccagcactgtg
gccgtcaagatgctcaaagacaacgcctccgacaaggacctggccgacctggtctcggag
atggaggtgatgaagctgattggccgacacaagaacatcatcaacctgctgggtgtctgc
acccaggaagggcccctgtatgtgatcgtggagtgcgccgccaagggaaacctgcgggag
ttcctgcgggcccggcgccccccaggccccgacctcagccctgacggtcctcggagcagt
gaggggccgctctccttcccagtcctggtctcctgcgcctaccaggtggcccgaggcatg
cagtatctggagtcccggaagtgtatccaccgggacctggctgcccgcaatgtgctggtg
accgaggacaatgtgatgaagattgctgactttgggctggcccgcggcgtccaccacatt
gactactataagaaaaccagcaatggccgcctgcctgtcaagtggatggcgcccgaggcc
ttgtttgaccgggtgtacacacaccagagtgacgtgtggtcttttgggatcctactgtgg
gagatcttcaccctcgggggctccccgtatcctggcatcccggtggaggagctgttctcg
ctgctgcgggagggacatcggatggaccgacccccacactgccccccagagctgtacggg
ttgatgcgtgagtgctggcacgcggcaccctcccagaggcctaccttcaagcaactggtg
gaggcgctggacaaggtcctgctggccgtctctgaggagtacctcgacctccgcctgacc
ttcggaccctattccccctctggtggggacgccagcagcacctgctcctccagcgattct
gtcttcagccacgaccccctgccactgggatccagctccttccccttcgggtctggggtg
cagacatga

KEGG   Pongo abelii (Sumatran orangutan): 100462098
Entry
100462098         CDS       T01416                                 

Gene name
FLT4
Definition
(RefSeq) vascular endothelial growth factor receptor 3 isoform X1
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon05200  Pathways in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100462098 (FLT4)
   04014 Ras signaling pathway
    100462098 (FLT4)
   04015 Rap1 signaling pathway
    100462098 (FLT4)
   04020 Calcium signaling pathway
    100462098 (FLT4)
   04151 PI3K-Akt signaling pathway
    100462098 (FLT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100462098 (FLT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462098 (FLT4)
  09162 Cancer: specific types
   05224 Breast cancer
    100462098 (FLT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100462098 (FLT4)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100462098 (FLT4)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   100462098 (FLT4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set Ig_6 C1-set
Other DBs
NCBI-GeneID: 100462098
NCBI-ProteinID: XP_024102878
Ensembl: ENSPPYG00000016139
LinkDB
Position
5
AA seq 1363 aa
MQRGAALCLQLWLCLGLLDGLASGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWA
WPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLREVHANDTGSYVCYYKYIKARI
EGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDG
QEVVWDDRRGMLVSTPLLRDALYLQCETTWGDRDFLSNPFLVHITGNELYDIQLLPRKSL
ELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNV
SQHDLGSYVCEANNGIQRFRESTEVIVHEKPFINVEWLKGPILEATAGDELVKLPVKLAA
YPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNV
PPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQR
DLMPQCRDWRVVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKV
GQDERLIYFYVTTIPDGFSIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHD
AHGNPLLLDCKNVHLFATPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRS
HDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEE
KSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILV
GTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGYGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPKGPLMVIVEYCKYGNLSNFLRAKRETFRPYAEKSPEQRGRF
RAMVELARLDRRRPGSSDRVLFARFSKNQGGARRASPDQEAEDLWLSPLTLEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQQLRDGTRMRAPELA
TPAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGRGLQEEDEVCMAPRGSQSSEEGSFS
QVSTMALHIVQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAQTRGSSRMKTFEEFPM
TPTTYKASVDNQTDSGMVLASEEFEQIESRHRQESGFSCKGPGQNVDVTRAHPDSQGRRR
RPDRGARGGQVFYNSEYGELSEPSKEDHCSPSARVTFFTDNSY
NT seq 4092 nt   +upstreamnt  +downstreamnt
atgcagcggggcgccgcgctgtgcctgcaactgtggctgtgcctgggactcctggacggc
ctggcgagtggctactccatgacccccccaaccttgaacatcacggaggagtcacacgtc
atcgacaccggtgacagcctgtccatctcctgcaggggacagcaccccctcgagtgggcc
tggccaggagctcaggaggcaccagccactggggacaaggacagcgaggacacgggggtg
gtgcgagactgcgagggcacagacgccaggccctactgcaaggtgttgctgctgcgcgag
gtgcacgccaacgacacaggcagctacgtctgctactacaagtacatcaaggcccgcatc
gagggcaccacggctgccagctcctacgtgttcgtgagagactttgagcagccattcatc
aacaagcctgacacgctcttggtcaacaggaaggacgccatgtgggtgccctgtctggtg
tccatccccggcctcaatgtcacgctgcgctcgcaaagctcggtgctgtggccagacggg
caggaggtggtgtgggacgaccggcggggcatgctggtgtccacaccgctgctgcgcgac
gccctgtacctgcagtgcgagaccacctggggggaccgggacttcctttccaaccccttc
ctggtacacatcacaggcaacgagctctatgacatccagctgttgcccaggaagtcgctg
gagctgctggtaggggagaagctggtcctgaactgcaccgtgtgggctgagttcaactcg
ggtgtcacctttgactgggactacccggggaagcaggcagagcggggtaagtgggtgccc
gagcgacgctcccagcagacccacacagaactctccagcatcctgaccatccacaacgtc
agccagcacgacctgggctcgtatgtgtgcgaggccaacaacggcatccagcgatttcgg
gagagcaccgaggtcattgtgcatgaaaagcccttcatcaacgtcgagtggctcaaagga
cccatcctggaggccacggcaggagacgagctggtgaagctgcccgtgaagctggcagcg
taccccccgcccgagttccagtggtacaaggatggaaaggcactgtccgggcgccacagt
ccacatgccctggtgctcaaggaggtgacagaggccagcacgggcacctacaccctcgcc
ttgtggaactccgctgctggcctgaggcgcaacatcagcctggagctggtggtgaatgtg
cccccccagatacacgagaaggaggcctcctcccccagcatctactcgcgtcacagccgc
caggccctcacctgcacggcctacggggtgcccctgcctctcagcatccagtggcactgg
cggccctggacaccctgcaagatgtttgcccagcgcagtctccggcggcggcagcagcga
gacctcatgccacagtgccgcgactggagggtggtgaccacgcaggatgccgtgaacccc
atcgagagcctggacacctggaccgagtttgtggagggaaagaataagactgtgagcaag
ctggtgatccagaatgccaacgtgtccgccatgtacaagtgtgtggtctccaacaaggtg
ggccaggatgagcggctcatctacttctatgtgaccaccatccccgacggcttcagcatc
gaatccaagccatccgaggaactactagagggccagcccgtgctcctgagctgccaagcc
gacagctacaagtacgagcatctgcgctggtaccgcctcaacctgtccacgctgcacgat
gcgcacgggaacccgctgctgctagactgcaagaacgtgcatctgttcgccacccctctg
gccgccagcctggaggaggtggcgcctggggcgcgccacgccacgctcagcctgagtatc
ccccgcgtcgcgcccgagcacgagggccactatgtgtgcgaagtgcaagaccggcgcagc
catgacaagcactgccacaagaagtacctgtcggtgcaggccctggaagcccctcggctc
acgcagaacttgaccgatctcctggtgaacgtgagcgactcactggagatgcagtgcttg
gtggccggagcgcacgcgcccagcatcgtgtggtacaaagacgagaggctgctggaggaa
aagtctggagtcgacttggcggactccaaccagaagctgagcatccagcgcgtgcgcgag
gaggatgcgggacgctatctgtgcagcgtgtgcaacgccaagggctgcgtcaactcctcc
gccagcgtggccgtggaaggctccgaggataaaggcagcatggagatcgtgatccttgtc
ggtaccggcgtcatcgctgtcttcttctgggtcctcctcctcctcatcttctgtaacatg
aggaggccggcccacgcagacatcaagacgggctacctgtccatcatcatggaccccggg
gaggtgcctctggaggagcaatgcgaatacctgtcctacgacgccagccagtgggaattc
ccccgagagcggctgcacctggggagagtgctcggctacggcgccttcgggaaggtggtg
gaagcctccgctttcggcatcaacaagggcagcagctgtgacaccgtggccgtgaaaatg
ctgaaagagggcgccacagccagcgagcaccgcgcgctgatgtcggagctcaagatccta
attcacatcggcaaccacctcaacgtggtcaacctcctgggggcgtgcaccaagccgaag
ggccccctcatggtgatcgtggagtattgcaagtacggcaacctctccaacttcctgcgc
gccaagcgggagaccttcaggccctatgcagagaagtctcccgagcagcgcggacgcttc
cgcgccatggtggagctcgccaggctggatcggaggaggccagggagcagcgacagggtc
ctcttcgcacggttctcgaagaaccagggcggagcgaggcgggcttctccagaccaagaa
gctgaggacctgtggctgagcccgctgaccttggaagaccttgtctgctacagcttccag
gtggccagaggaatggagttcctggcttcccgaaagtgcatccacagagacctggctgct
cggaacattctgctgtcagaaagcgacgtggtgaagatctgtgactttggccttgcccgg
gacatctacaaagaccctgactacgtccgcaagggcagtgcccggctgcccctgaagtgg
atggcccctgaaagcatcttcgacaaggtgtacaccacgcagagtgacgtgtggtccttt
ggggtgcttctctgggagatcttctctctgggggcctccccataccctggggtgcagatc
aatgaggagttctgtcagcagctgagagacggcacaaggatgagggccccggagctggcc
actcccgccatacgccgcatcatgctgaactgctggtccggagaccccaaggcgagacct
gcattctcggagctggtggagatcctgggggacctgctccagggcaggggtctgcaagag
gaagacgaggtctgcatggccccgcgcggctctcagagctcagaagagggcagcttctcg
caggtgtccaccatggccctacacatcgtccaggctgacgctgaggacagcccaccaagc
ctgcagcgccacagcctggccgccaggtattacaactgggtgtcctttcccgggtgcctg
gccagaggggctcagacccgtggttcctccaggatgaagacatttgaggaattccccatg
accccaacaacctacaaagcctctgtggacaaccagacagacagtgggatggtgctggcc
tcggaggagtttgagcagatagagagcaggcatagacaagaaagcggcttcagctgtaaa
ggacctggccagaatgtggatgtgaccagggcacaccctgactcccaagggaggcggcgg
cggcctgaccggggggcccgaggaggccaggtgttttacaacagcgagtatggggagctg
tcggagccaagcaaggaggaccactgctccccatctgcccgcgtgactttcttcacagac
aacagctactaa

KEGG   Pongo abelii (Sumatran orangutan): 100462446
Entry
100462446         CDS       T01416                                 

Gene name
KDR
Definition
(RefSeq) vascular endothelial growth factor receptor 2
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04370  VEGF signaling pathway
pon04510  Focal adhesion
pon05205  Proteoglycans in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100462446 (KDR)
   04014 Ras signaling pathway
    100462446 (KDR)
   04015 Rap1 signaling pathway
    100462446 (KDR)
   04370 VEGF signaling pathway
    100462446 (KDR)
   04020 Calcium signaling pathway
    100462446 (KDR)
   04151 PI3K-Akt signaling pathway
    100462446 (KDR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100462446 (KDR)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100462446 (KDR)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100462446 (KDR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100462446 (KDR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100462446 (KDR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100462446 (KDR)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100462446 (KDR)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   100462446 (KDR)
CD molecules [BR:pon04090]
 Proteins
  100462446 (KDR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C2-set_2 Ig_4
Other DBs
NCBI-GeneID: 100462446
NCBI-ProteinID: XP_002814831
Ensembl: ENSPPYG00000014765
UniProt: H2PDE2 A0A663DHE2
LinkDB
Position
4
AA seq 1356 aa
MESKVLLAVALWLCVGTRAAFVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGE
KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPVKYLGYPPP
EIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECPNEPSQAVSVTNPY
PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQVANVSALYKCEAVNKVGRGE
RVISFHVTRGPEITLQPDMQPTEQESVSLWCAADRSTFENLTWYKLGPQPLPIHMGELPT
PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLT
VLERVAPMITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLAPSFSGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
SEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV
NT seq 4071 nt   +upstreamnt  +downstreamnt
atggagagcaaggtgctgctggccgtcgccctgtggctctgcgtggggacccgggccgcc
tttgtgggtttgcctagtgtttctcttgatctgcccaggctcagcatacaaaaagacata
cttacaattaaggctaatacaactcttcaaattacttgcaggggacagagggacttggac
tggctttggcccaataatcagagtggcagtgagcaaagggtggaggtgactgagtgcagc
gatggcctcttctgtaagacactcacaattccaaaagtgatcggaaatgacactggagcc
tacaagtgcttctaccgggaaactgacttggcctcggtcatttatgtctatgttcaagat
tacagatctccatttattgcttctgttagtgaccaacatggagtcgtgtacattacagag
aacaaaaacaaaactgtggtgattccatgtctcgggtccatttcaaatctcaacgtgtca
ctttgtgcaaggtacccagaaaagagatttgttcctgatggaaacagaatttcctgggac
agcaagaagggctttactattcccagctacatgatcagctatgctggcatggtcttctgt
gaagcaaaaattaatgatgaaagttaccagtctattatgtacatagttgtcgttgtaggg
tataggatttatgatgtggttctgagtccgtctcacggaattgaactatctgttggagaa
aagcttgtcttaaattgtacagcaagaactgaactaaatgtggggattgacttcaactgg
gaatacccttcttcgaagcatcagcataagaaacttgtaaaccgagacctaaaaacccag
tctgggagtgagatgaagaaatttttgagcaccttaactatagatggtgtaacccggagt
gaccaaggattgtacacctgtgcagcgtccagtgggctgatgaccaagaagaacagcact
tttgtcagggtccatgaaaaaccttttgttgcttttggaagtggcatggaatctctggtg
gaagccacggtgggggagcgtgtcagaatccctgtgaagtaccttggttacccaccccca
gaaataaaatggtataaaaatggaataccccttgagtccaatcacacaattaaagcgggg
catgtactgacgattatggaagtgagtgaaagagacacagggaattacactgtcatcctt
accaatcccatttcaaaggagaagcagagccacgtggtctctctggttgtgtatgtccca
ccccagattggtgagaaatcgctgatctctcctgtggattcctaccagtatggcaccact
caaacgctgacgtgtacggtctatgccattcctcccccgcatcacatccactggtattgg
cagttggaggaagagtgccccaacgagcccagccaagctgtctcagtgacaaacccatac
ccttgtgaagaatggagaagtgtggaggactttcagggaggaaataaaattgaagtcaat
aaaaatcaatttgctctaattgaaggaaaaaacaaaactgtaagtacccttgttatccaa
gtggcaaatgtgtcagctttgtacaaatgtgaagcggtcaacaaagtcgggagaggagag
agggtgatctccttccacgtgaccaggggtcctgaaattactttgcaacctgacatgcag
cccactgagcaggagagcgtgtctttgtggtgcgctgcagacagatctacatttgagaac
ctcacatggtacaagcttggcccacagcctctgccaatccacatgggagagttgcccaca
cctgtttgcaagaacttggatactctttggaaattgaatgccaccatgttctctaatagc
acaaatgacattttgatcatggagcttaagaatgcatccttgcaggaccaaggagactat
gtctgccttgctcaagacaggaagaccaagaaaagacattgcgtggtcagacagctcaca
gtcctagagcgtgtggcacccatgatcacaggaaacctggagaatcagacgacaagtatt
ggggaaagcatcgaagtctcatgcacggcatctgggaatccccctccacagatcatgtgg
tttaaagataatgagacccttgtagaagactcaggcattgtattgaaggatgggaaccgg
aacctcactatccgcagagtgagaaaggaggacgaaggcctctacacctgccaggcatgc
agtgttcttggctgtgcaaaagtggaggcattcttcataatagaaggtgcccaggaaaag
acgaacttggaaatcattattctagtaggcacagcggtgattgccatgttcttctggcta
cttcttgtcatcatcctacggaccgttaagcgggctaatggaggggaactgaagacaggc
tacttgtccatcgtcatggatccagatgaactcccattggacgaacattgtgaacgactg
ccttatgatgccagcaaatgggaattccccagagaccggctgaagctaggtaagcctctt
ggccgtggtgcctttggccaagtgattgaagcagatgcctttggaattgacaagacagca
acttgcaggacagtagctgtcaaaatgttgaaagaaggagcaacacacagtgagcatcga
gccctcatgtctgaactcaagatcctcattcatattggtcaccatctcaatgtggtcaac
cttctaggtgcctgtaccaagccaggagggccactcatggtgattgtggaattctgcaaa
tttggaaacctatccacttacctgaggagcaagagaaatgaatttgtcccctacaagacc
aaaggggcacgattccgtcaagggaaagactacgttggagcaatccctgtggatctgaaa
cggcgcttggacagcatcaccagtagccagagctcagctagctctggatttgtggaggag
aagtccctcagtgatgtagaagaagaggaagctcctgaagatctgtataaggacttcctg
accttggagcatctcatctgttacagcttccaagtggctaagggcatggagttcttggca
tcgcgaaagtgtatccacagggacctggcggcacgaaatatcctcttatcggagaagaac
gtggttaaaatctgtgactttggcttggcccgggatatttataaagatccagattatgtc
agaaaaggagatgctcgcctccctttgaaatggatggccccagaaacaatttttgacaga
gtgtacacaatccagagtgacgtctggtcttttggtgttttgctgtgggaaatattttcc
ttaggtgcttctccatatcctggggtaaagattgatgaagaattttgtaggcgactgaaa
gaaggaactagaatgagggcccccgattatactacaccagaaatgtaccagaccatgctg
gactgctggcacggggagcccagtcagagacccacgttttcagagttggtggaacatttg
ggaaatctcttgcaagctaatgctcagcaggatggcaaagactacattgttcttccgata
tcagagactttgagcatggaagaggattctggactctctctgcctacctcacctgtttcc
tgtatggaggaggaggaagtatgtgaccccaaattccattatgacaacacagcaggaatc
agtcagtatctgcagaacagtaagcgaaagagcaggcctgtgagtgtaaaaacatttgaa
gatatcccattagaagaaccagaagtaaaagtaatcccagatgacaaccagacggacagt
ggtatggttcttgcctcagaagagctgaaaactttggaagacagaaccaaattagctcca
tcttttagtggaatggtgcccagcaaaagcagggagtctgtggcatctgaaggctcaaac
cagacaagcggctaccagtccggatatcactccgatgacacagacaccactgtgtactcc
agtgaggaagcagaacttttaaagctgatagagattggagtgcaaaccggcagcacagcc
cagattctccagcctgactcggggaccacactgagctctcctcctgtttaa

KEGG   Pongo abelii (Sumatran orangutan): 100938677
Entry
100938677         CDS       T01416                                 

Gene name
ERBB4
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-4 isoform X1
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon05014  Amyotrophic lateral sclerosis
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100938677 (ERBB4)
   04012 ErbB signaling pathway
    100938677 (ERBB4)
   04020 Calcium signaling pathway
    100938677 (ERBB4)
   04151 PI3K-Akt signaling pathway
    100938677 (ERBB4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100938677 (ERBB4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100938677 (ERBB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100938677 (ERBB4)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100938677 (ERBB4)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100938677 (ERBB4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH DUF3951
Other DBs
NCBI-GeneID: 100938677
NCBI-ProteinID: XP_024099518
Ensembl: ENSPPYG00000013138
LinkDB
Position
2B
AA seq 1308 aa
MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYD
GEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVP
YRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERS
PRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAED
EYVNEPLYLNTFANTLGKAEYLKNNVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
NT seq 3927 nt   +upstreamnt  +downstreamnt
atgaagccggcgacaggactttgggtctgggtgagccttctcgtggcggcggggaccgtc
cagcccagcgattctcagtcagtgtgtgcaggaacggagaataaactgagctctctctct
gacttggaacagcagtaccgagccttgcgcaagtactatgaaaactgtgaggttgtcatg
ggcaacctggagataaccagcattgagcacaaccgggacctctccttcctgcggtctgtt
cgagaagtcacaggctacgtgttagtggctcttaatcagtttcgttacctgcctctggag
aatttacgcattattcgtgggacaaaactttatgaggatcgatatgccttggcaatattt
ttaaactacagaaaagatggaaactttggacttcaagaacttggattaaagaacttgaca
gaaatcctaaatggtggagtctatgtagaccagaacaaattcctttgttatgcggacacc
attcattggcaagatattgttcggaacccatggccttccaacttgactcttgtgtcaaca
aatggtagttcaggatgtggacgttgccataagtcctgtactggccgttgctggggaccc
acagaaaatcattgccagactttgacaaggacggtgtgtgcagaacaatgtgacggcaga
tgctacggaccttacgtcagtgactgctgccatcgagaatgtgctggaggctgctcagga
cctaaggatacagactgctttgcctgcatgaatttcaatgacagtggagcatgtgttact
cagtgtccccaaacctttgtctacaatccaaccacttttcaactggagcacaatttcaat
gcaaagtacacatatggagcattctgtgtcaagaagtgtccacataactttgtggtagat
tccagttcttgtgtgcgtgcctgccctagttccaagatggaagtagaagaaaatgggatt
aaaatgtgtaaaccttgcactgacatttgcccaaaagcttgtgatggcattggcacagga
tcattgatgtcagctcagactgtggattccagtaacattgacaaattcataaactgtacc
aagatcaatgggaatttgatctttctggtcactggtattcatggggacccttacaatgca
attgaagccatagacccagagaaactgaatgtctttcggacagtcagagagataacaggt
ttcctgaacatacagtcatggccaccaaacatgactgacttcagtgttttttctaacctg
gtgacaattggtggaagagtactctatagtggcctgtccttgcttatcctcaagcaacag
ggcatcacctctctacagttccagtccctgaaggaaatcagcgcaggaaacatctatatt
actgacaacagcaacctgtgttattatcataccattaactggacaacactcttcagcaca
atcaaccaaagaatagtaatccgggacaatagaaaagctgaaaactgtactgctgaagga
atggtgtgcaaccatctgtgttccagtgatggctgttggggacctgggccagaccagtgt
ctgtcgtgtcgccgcttcagtagaggaaggatctgcatagagtcttgtaacctctatgat
ggtgaatttcgggagtttgagaatggctccatctgtgtggagtgtgacccccagtgtgag
aagatggaagatggcctcctcacatgccatggaccgggtcctgacaactgtacaaagtgc
tctcattttaaagatggcccaaactgtgtggaaaaatgtccagatggcttacagggggca
aacagtttcattttcaagtatgctgatccggatcgggagtgccacccatgccatccaaac
tgcacccaagggtgtaacggtcccactagtcatgactgcatttactacccatggacgggc
cattccactttaccacaacatgctagaactcccctgattgcagctggagtaattggtggg
ctcttcattctggtcattgtgggtctgacatttgctgtttatgttagaaggaagagcatc
aaaaagaaaagagccttgagaagattcttggaaacagagttggtggaaccattaactccc
agtggcacagcacccaatcaagctcaacttcgtattttgaaagaaactgagctgaagagg
gtaaaagtccttggctcaggtgcttttggaacggtttataaaggtatttgggtacctgaa
ggagaaactgtgaagattcctgtggctattaagattcttaatgagacaactggtcccaag
gcaaatgtggagttcatggatgaagctctgatcatggcaagtatggatcatccacaccta
gtacggttgctgggtgtgtgtctgagcccaaccatccagctggttactcaacttatgccc
catggctgcctgttggagtatgtccacgagcacaaggataacattggatcacaactgctg
cttaactggtgtgtccagatagctaagggaatgatgtacctggaagaaagacgactcgtt
catcgggatttggcagcccgtaatgtcttagtgaaatctccaaaccatgtgaaaatcaca
gattttgggctagccagactcttggaaggagatgaaaaggagtacaatgctgatggagga
aagatgccaattaaatggatggctctggagtgtatacattacaggaaattcacccatcag
agtgacgtttggagctatggagttactatatgggaactgatgacctttggaggaaaaccc
tatgatggaattccaacgcgagaaatccctgatttattagagaaaggagaacgtttgcct
cagcctcccatctgcactattgacgtttacatggtcatggtcaaatgttggatgattgat
gctgacagtagacctaaatttaaggaactggctgctgagttttcaaggatggctcgagac
cctcaaagatacctagttattcagggtgatgatcgtatgaagcttcccagtccaaatgac
agcaagttctttcagaatctcttggatgaagaggatttggaagatatgatggatgctgag
gagtacttggtccctcaggctttcaacatcccacctcccatctatacttccagagcaaga
attgactcaaataggagtgaaattggacacagccctcctcctgcctacacccccatgtca
ggaaaccagtttgtataccgagatggaggttttgctgcagaacaaggagtgtctgtgccc
tacagagccccaactagcacaattccagaagctcctgtggcacagggtgctactgctgag
atttttgatgactcctgctgtaatggcaccctacgcaagccagtggcaccccatgtccaa
gaggacagtagcacccagaggtacagcgctgaccccaccgtgtttgccccagaacggagc
ccacgaggcgagctggatgaggagggttacatgactcctatgcgagacaaacccaaacaa
gaatacctgaatccagtggaggagaacccttttgtttctcggagaaaaaatggagacctt
caagcattggataatcccgaatatcacaatgcatccaatggtccacccaaggccgaggat
gagtatgtgaatgagccactgtacctcaacacctttgccaacaccttgggaaaagctgag
tacctgaagaacaacgtactgtcagtgccagagaaggccaagaaagcgtttgacaaccct
gactactggaaccacagcctgccacctcggagcacccttcagcacccagactacctgcag
gagtacagcacaaaatatttttataaacagaatgggcggatccggcctattgtggcagag
aatcctgaatacctctctgagttctccctgaagccaggcactgtgctgccgcctccacct
tacagacaccggaatactgtggtgtaa

DBGET integrated database retrieval system