KEGG   Pongo abelii (Sumatran orangutan): 100137030
Entry
100137030         CDS       T01416                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor precursor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04520  Adherens junction
pon05100  Bacterial invasion of epithelial cells
pon05144  Malaria
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
pon05218  Melanoma
pon05223  Non-small cell lung cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100137030 (MET)
   04014 Ras signaling pathway
    100137030 (MET)
   04015 Rap1 signaling pathway
    100137030 (MET)
   04020 Calcium signaling pathway
    100137030 (MET)
   04151 PI3K-Akt signaling pathway
    100137030 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100137030 (MET)
   04520 Adherens junction
    100137030 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100137030 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100137030 (MET)
   05202 Transcriptional misregulation in cancer
    100137030 (MET)
   05206 MicroRNAs in cancer
    100137030 (MET)
   05205 Proteoglycans in cancer
    100137030 (MET)
   05230 Central carbon metabolism in cancer
    100137030 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100137030 (MET)
   05226 Gastric cancer
    100137030 (MET)
   05218 Melanoma
    100137030 (MET)
   05211 Renal cell carcinoma
    100137030 (MET)
   05223 Non-small cell lung cancer
    100137030 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100137030 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    100137030 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100137030 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100137030 (MET)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100137030 (MET)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  MET family
   100137030 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 100137030
NCBI-ProteinID: NP_001162038
Ensembl: ENSPPYG00000017932
UniProt: Q2IBD8 A0A2J8UPG2
LinkDB
Position
7
AA seq 1390 aa
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETLIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHPLNQNGYTLVVTGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECSSGTWTQQICLPAIYKVFPSSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNILKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
GISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISIALLLLLGFFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
TRPASFWETS
NT seq 4173 nt   +upstreamnt  +downstreamnt
atgaaggcccccgctgtgcttgcacctggcatcctcgtgctcctgtttaccttggtgcag
aggagcaatggggagtgtaaagaggcactagcaaagtccgagatgaatgtgaatatgaag
tatcagcttcccaacttcaccgcggaaacactcatccagaatgtcattctacatgagcat
cacattttccttggtgccactaactacatttatgttttaaatgaggaagaccttcagaag
gttgctgagtacaagaccgggcctgtgttggaacacccagattgtttcccatgtcaggac
tgcagcagcaaagccaatttatcaggaggcgtttggaaagataacatcaacatggctcta
gttgtcgacacctactatgatgatcaactcattagctgtggcagcgtcaacagagggacc
tgccagcgacatgtctttccccacaatcatactgctgacatacagtcggaggttcactgc
atattctccccacagatagaagagcccagccagtgtcctgactgtgtggtgagcgccctg
ggagccaaagtcctttcatctgtaaaggaccggttcatcaacttctttgtaggtaatacc
ataaattcttcttatttcccagatcatccattgcattcaatatcagtgagaaggctaaag
gaaacgaaagatggttttatgtttttgacggaccagtcctacattgatgttttacctgag
ttcagagattcttaccccattaagtatgtccatgcctttgaaagcaacaattttatttac
ttcttgacggtccaaagggaaactctagatgctcagacttttcacacaagaataatcagg
ttctgttccataaactctggattgcattcctacatggaaatgcctctggagtgtattctt
acagaaaagagaaaaaagagatccacaaagaaggaagtgtttaatatccttcaggctgcg
tatgtcagcaagcctggggcccaacttgctagacaaataggagccagcctgaatgatgac
attctctttggggtgttcgcacaaagcaagccagattctgccgaaccaatggatcgatct
gccatgtgtgcattccctatcaaatatgtcaacgacttcttcaacaagatcgtcaacaaa
aacaatgtgagatgtctccagcatttttacggacccaatcatgagcactgttttaatagg
acacttctgagaaattcatcaggctgtgaagcgcgccgtgatgaatatcgaacagagttt
accacagctttgcagcgcgttgacttattcatgggtcaattcagcgaagtcctcttaaca
tctatatccaccttcattaaaggagacctcaccatagctaatcttgggacatcagagggt
cgcttcatgcaggttgtggtttctcgatcaggaccatcaacccctcatgtgaattttctc
ctggactcccatccggtgtctccagaagtgattgtggagcatccattaaaccagaatggc
tacacactggttgtcactgggaagaagatcacgaagatcccattgaatggcttgggctgc
agacatttccagtcctgcagtcagtgcctctctgccccaccctttgttcagtgtggctgg
tgccatgacaaatgtgtgcgatcggaggaatgctcgagcgggacatggactcaacagatc
tgtctgcctgcaatctacaaggttttcccaagtagtgcaccccttgaaggagggacaagg
ctgaccatatgtggctgggactttggatttcggaggaataataaatttgatttaaagaaa
actagagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgatgaat
atattgaaatgcacagttggtcctgccatgaataagcatttcaatatgtccataattatt
tcaaatggccacgggacaacacaatacagtacattctcctatgtggatcctgtaataaca
ggtatttcgccgaaatatggtcctatggctggtggcactttacttactttaactggaaat
tacctaaacagtgggaattccagacacatttcaattggtggaaaaacatgtactttaaaa
agtgtgtcaaacagtattcttgaatgttataccccagcccaaaccatttcaactgagttt
gctgttaaattgaaaattgacttagccaaccgagagacaagcatcttcagttaccgggaa
gatcccattgtctacgaaattcatccaaccaaatcttttattagtggtgggagcacaata
acaggtgttgggaaaaacctgaattcagttagtgtcccgaggatggtcataaatgtgcat
gaagcaggaaggaactttactgtggcatgtcaacatcgctctaattcagagataatctgc
tgtaccactccttccctgcaacagctgaatctgcaactccccctgaaaaccaaagccttt
ttcatgttagatgggatcctttccaaatactttgatctcatttatgtacataatcctgtg
tttaagccttttgaaaagccagtgatgatctcaatgggcaatgaaaatgtactggaaatt
aagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaataag
agctgtgagaatatacacttacattctgaagccgttttatgcacggtccccaatgacctg
ctgaaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaaccgtcctt
ggaaaagtaatagttcaaccagatcagaatttcacaggattgattgctggtgttgtctca
atatcaatagcactgttattactacttgggtttttcctgtggctgaaaaagagaaagcaa
attaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaatct
gtagactaccgagctacttttccagaagatcagtttcctaattcatctcagaacggttca
tgccgacaagtgcagtatcctctgacagacatgtcccccatcctaactagtggggactct
gatatatccagtccattactgcaaaatactgtccacattgacctcagtgccctaaatcca
gagctggtccaggcagtgcaacatgtagtgattgggcccagtagcctgattgtgcatttc
aatgaagtcataggaagagggcattttggttgtgtatatcatgggactttgttggacaat
gatggcaagaaaattcactgtgctgtgaaatccttgaatagaatcactgacataggagaa
gtttcccaatttctgaccgagggaatcatcatgaaagattttagtcatcccaatgtcctc
tcgctcctgggaatctgcctgcgaagtgaagggtctccactggtggtcctaccatacatg
aaacatggagatcttcgaaatttcattcgaaatgagactcataatccaactgtaaaagat
cttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcacagtcaaggtt
gctgattttggtcttgccagagacatgtatgataaagaatactatagtgtacacaacaaa
acaggtgcaaagctgccagtgaagtggatggctttggaaagtctgcaaactcaaaagttt
accaccaagtcagatgtgtggtcctttggcgtgctcctctgggagctgatgacaagagga
gccccaccttatcctgacgtgaacacctttgatataactgtttacttgttgcaagggaga
aggctcctacaacccgaatactgcccagaccccttatatgaagtaatgctaaaatgctgg
caccctaaagccgaaatgcgcccatccttttctgaactggtgtcccggatatcagcgatc
ttctctactttcattggggagcactatgtccatgtgaacgctacttatgtgaacgtaaaa
tgtgtcgctccatatccttctctgttgtcatcagaagataacgctgatgatgaggtggac
acacgaccagcctccttctgggagacatcatag

KEGG   Pongo abelii (Sumatran orangutan): 100172156
Entry
100172156         CDS       T01416                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04114  Oocyte meiosis
pon04140  Autophagy - animal
pon04144  Endocytosis
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04510  Focal adhesion
pon04520  Adherens junction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04730  Long-term depression
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172156 (IGF1R)
   04014 Ras signaling pathway
    100172156 (IGF1R)
   04015 Rap1 signaling pathway
    100172156 (IGF1R)
   04066 HIF-1 signaling pathway
    100172156 (IGF1R)
   04068 FoxO signaling pathway
    100172156 (IGF1R)
   04151 PI3K-Akt signaling pathway
    100172156 (IGF1R)
   04152 AMPK signaling pathway
    100172156 (IGF1R)
   04150 mTOR signaling pathway
    100172156 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100172156 (IGF1R)
   04140 Autophagy - animal
    100172156 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100172156 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100172156 (IGF1R)
   04520 Adherens junction
    100172156 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    100172156 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100172156 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    100172156 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    100172156 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    100172156 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    100172156 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172156 (IGF1R)
   05202 Transcriptional misregulation in cancer
    100172156 (IGF1R)
   05205 Proteoglycans in cancer
    100172156 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100172156 (IGF1R)
   05214 Glioma
    100172156 (IGF1R)
   05218 Melanoma
    100172156 (IGF1R)
   05215 Prostate cancer
    100172156 (IGF1R)
   05224 Breast cancer
    100172156 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100172156 (IGF1R)
   01522 Endocrine resistance
    100172156 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100172156 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100172156 (IGF1R)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100172156 (IGF1R)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100172156 (IGF1R)
CD molecules [BR:pon04090]
 Proteins
  100172156 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Recep_L_domain fn3 Furin-like Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 100172156
NCBI-ProteinID: NP_001125259
Ensembl: ENSPPYG00000006808
UniProt: Q5RCL1
LinkDB
Position
15
AA seq 1064 aa
MQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLIN
IRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSFYVL
DNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNG
ERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDA
CGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILY
IRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYC
SKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFE
NFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVD
NKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFVRTMPAEGADDIPGPVTWEPR
PENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTA
RIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRN
NSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVK
DEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMT
RGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMV
AEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLW
EIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRLAFLEII
SSIKDEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGH
KAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgcaggagtgcccctcgggcttcatccgcaacggcagccagagcatgtactgcatccca
tgtgaaggtccttgccccaaggtctgtgaggaagaaaagaaaacaaagaccattgattct
gttacttctgctcagatgctccaaggatgcaccatcttcaagggcaatttgctcattaac
atccgacgggggaataacattgcttcagaactggagaacttcatggggctcatcgaggtg
gtgacgggctacgtgaagatccgccattctcatgccttggtctccttgtccttcctaaaa
aaccttcgcctcatcttaggagaggagcagctagaagggaattactccttctacgtcctc
gacaaccagaacttgcagcaactatgggactgggaccaccgcaacctgaccatcaaagca
gggaaaatgtactttgctttcaatcccaaattatgtgtttctgaaatttaccgcatggag
gaagtgacggggactaaaggacgccaaagcaaaggggacataaacaccaggaacaacggg
gagagagcctcctgtgaaagtgatgtcctgcatttcacctccaccaccacgtcgaagaat
cgcatcatcataacctggcaccggtaccggccccctgactacagggatctcatcagcttc
accgtttactacaaggaagcaccctttaagaatgtcacggagtatgatgggcaggacgcc
tgcggctccaacagctggaacatggtggacgtggacctcccacccaacaaggacgtggag
cccggcatcttactgcatgggctgaagccctggactcagtacgccgtttacgtcaaggct
gtgaccctcaccatggtggagaacgaccatatccgtggagccaagagtgagatcttgtac
attcgcaccaatgcttcagttccttccattcccttggacgttctttcagcatcgaactcc
tcttctcagttaatcgtgaagtggaaccctccctctctgcccaacggcaacctgagttac
tacattgtgcgctggcagcggcagcctcaggacggctacctttaccggcacaattactgc
tccaaagacaaaatccccatcaggaagtatgccgacggcaccatcgacattgaggaagtc
acagagaaccccaagactgaggtgtgtggtggtgagaaagggccttgctgcgcctgcccc
aaaactgaagccgagaagcaggctgagaaggaggaggctgagtaccgcaaagtctttgag
aatttcctgcacaactccatcttcgtgcccagacctgaaaggaagcggagagatgtcatg
caagtggccaacaccaccatgtccagccgaagcaggaacaccacggccgcagacacgtac
aacatcaccgacccagaagagctggagacagagtaccctttctttgagagcagagtggat
aacaaggagagaactgtcatttctaaccttcggcctttcacattgtaccgcatcgatatc
cacagctgcaatcatgaggctgagaagctgggctgcagcgcctccaacttcgtctttgta
aggactatgcccgcagaaggagcagatgacattcctgggccagtgacctgggagccaagg
cctgaaaactccatctttttaaagtggccagaacctgagaatcccaatggattgattcta
atgtatgaaataaaatacggatcacaagttgaggatcagcgagaatgtgtgtccagacag
gaatacaggaagtatggaggggccaagctaaaccggctaaacccggggaactacacagcc
cggattcaggccacatctctctctgggaatgggtcgtggacagatcctgtgttcttctat
gtccaggccaaaacaggatatgaaaacttcatccatctgatcatcgctctgcccgtcgct
gtcctgttgattgtgggagggttggtgattatgctgtacgtcttccatagaaagagaaat
aacagcaggctggggaatggagtgctgtatgcctctgtgaacccggagtacttcagcgct
gcggatgtgtacgttcctgatgagtgggaggtggctcgggagaagatcaccatgagccgg
gaacttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggtgtggtgaaa
gatgaacctgaaaccagagtggccattaaaacagtgaacgaggccgcaagcatgcgtgaa
aggatcgagtttctcaacgaagcttctgtgatgaaggagttcaattgtcaccatgtggtg
cgattgctgggtgtggtgtcccaaggccagccaacactggtcatcatggaactgatgaca
cggggcgatctcaaaagttatctccggtctctgaggccagaaatggagaataatccagtc
ctagcacctccaagcctaagcaagatgattcagatggccggagagattgcagacggcatg
gcatacctcaacgccaacaagttcgtccacagagaccttgctgcccggaattgcatggta
gccgaagatttcacagtcaaaatcggagattttggtatgacgcgagatatctatgagaca
gactattaccggaaaggagggaaagggctgctgcccgtgcgctggatgtctcccgagtcc
ctcaaggatggagtcttcaccacttactcggacgtctggtccttcggggtcgtcctctgg
gagattgccacactggccgagcagccctaccagggcttgtccaacgagcaagtccttcgc
ttcgtcatggagggcggccttctggacaagccagacaactgtcctgacatgctgtttgaa
ctgatgcgcatgtgctggcagtataaccccaagatgaggcttgccttcctggagatcatc
agcagcatcaaagacgagatggagcctggcttccgggaggtctccttctactacagcgag
gagaacaagctgcccgagccggaggaactggacctcgagccagagaacatggagagcgtc
cccctggacccctcggcctcctcgtcctccctgccactgcccgacagacactcaggacac
aaggccgagaacggccccggccctggagtactggtcctccgcgccagcttcgacgagaga
cagccttacgcacacatgaacgggggccgcaagaacgagcgggccttgccactgccccag
tcttcgacctgctga

KEGG   Pongo abelii (Sumatran orangutan): 100174545
Entry
100174545         CDS       T01416                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 precursor
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04520  Adherens junction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04714  Thermogenesis
pon04810  Regulation of actin cytoskeleton
pon04928  Parathyroid hormone synthesis, secretion and action
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05215  Prostate cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100174545 (FGFR1)
   04014 Ras signaling pathway
    100174545 (FGFR1)
   04015 Rap1 signaling pathway
    100174545 (FGFR1)
   04020 Calcium signaling pathway
    100174545 (FGFR1)
   04151 PI3K-Akt signaling pathway
    100174545 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100174545 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100174545 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100174545 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100174545 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100174545 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174545 (FGFR1)
   05205 Proteoglycans in cancer
    100174545 (FGFR1)
   05230 Central carbon metabolism in cancer
    100174545 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    100174545 (FGFR1)
   05215 Prostate cancer
    100174545 (FGFR1)
   05224 Breast cancer
    100174545 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100174545 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100174545 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100174545 (FGFR1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100174545 (FGFR1)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100174545 (FGFR1)
CD molecules [BR:pon04090]
 Proteins
  100174545 (FGFR1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100174545 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_4 Ig_6 Pkinase_fungal DUF1615
Other DBs
NCBI-GeneID: 100174545
NCBI-ProteinID: NP_001127472
Ensembl: ENSPPYG00000018526
UniProt: Q5R8Q3
LinkDB
Position
8
AA seq 820 aa
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSMPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSG
TPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHT
YQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGP
DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEAL
EERPAVMTSPLYLEIIIYCAGAFLISCMVGSVIVYKTKSGTKKSDFHSQMAVHKLAKSIP
LRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGK
PLGEGCFGQVVLAEAVGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPD
TRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactctgcacc
gctaggccatccccaaccttgcctgaacaagcccagccctggggagcccctgtggaagtg
gagtccttcctggtccaccccggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtgcagagcatcaactggctgcgggacggggtgcagctggcggaaagcaaccgcacccgc
atcacaggggaggaggtggaggtgcaggactccatgcccgcagactccggcctctatgct
tgcgtaaccagcagcccctcgggcagtgacaccacctacttctccgtcaatgtttcagat
gctctcccctcctcggaggatgatgatgatgatgatgactcctcttcagaggagaaagaa
acagataacaccaaaccaaaccccgtagctccatattggacatccccagaaaaaatggaa
aagaaattgcatgcagtgccggctgccaagacagtgaagttcaaatgcccttccagtggg
accccaaaccccacactgcgctggttgaaaaatggcaaagaattcaaacctgaccacaga
attggaggctacaaggtccgttatgctacctggagcatcataatggactccgtggtgccc
tctgacaagggcaactacacctgcattgtggagaatgagtatggcagcatcaaccacacg
taccagctggatgtcgtggagcggtcccctcaccgacccatcctgcaagcagggttgccc
gccaacaagacagtggccctgggtagcaacgtggagttcatgtgtaaggtgtacagtgat
ccgcagccgcacatccagtggctaaagcacatcgaggtgaacgggagcaagattggtcca
gacaacctgccttatgtccagatcttgaagactgctggagttaataccaccgacaaagag
atggaggtgcttcacttaagaaatgtctcctttgaggacgcaggggagtatacgtgcttg
gcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaagccctg
gaagagaggccggcagtgatgacctcgcccctgtacctggagatcatcatctattgtgca
ggggccttcctcatctcctgcatggtggggtcggtcatcgtctacaagacgaagagtggt
accaagaagagcgacttccacagccagatggctgtgcacaagctggccaagagcatccct
ctgcgcagacaggtaacagtgtctgctgactccagtgcatccatgaactctggagttctt
ctggttcggccgtcacggctctcctccagtgggactcccatgctagcaggggtctctgag
tatgagcttcccgaagaccctcgctgggagctgcctcgggacagactggtcttaggcaaa
cccctgggagagggctgctttgggcaggtggtgttggcagaggctgtcgggctggacaag
gacaaacccaaccgtgtgaccaaagtggctgtgaagatgttgaagtcggacgcaacagag
aaagacttgtcagacctgatctcagaaatggagatgatgaagatgatcgggaagcataag
aatatcatcaacctgctgggggcctgcacgcaggacggtcccttgtatgtcatcgtggag
tatgcctccaagggcaacctgcgggagtacctgcaggcccggaggcccccagggctggaa
tactgctacaaccccagccacaacccagaggagcagctctcctccaaggacctggtgtcc
tgcgcctaccaggtggcccgaggcatggagtatctggcctccaagaagtgcatacaccga
gacctggcggccaggaatgtcctggtgacagaggacaatgtgatgaagatagcagacttt
ggcctcgcacgggacattcaccacatcgactactataaaaagacaaccaacggccgactg
cctgtgaagtggatggcgcccgaggcattatttgaccggatctacacccaccagagtgat
gtgtggtcttttggggtgctcctgtgggagatcttcactctgggtggctccccgtacccc
ggtgtgcctgtggaggagcttttcaagctgctgaaggagggtcaccgcatggacaagccc
agtaactgcaccaacgagctgtacatgatgatgcgggactgctggcatgcagtgccctca
cagagacccaccttcaagcagctggtggaagacctggaccgcatcgtggccttgacctcc
aaccaggagtacctggacctgtccatgcccctggaccagtactcccccagctttcccgac
acccggagctctacgtgctcctcaggggaggattccgtcttctctcatgagccgctgccc
gaggagccctgcctgccccgacacccagcccagcttgccaatggcggactcaaacgccgc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100431735
Entry
100431735         CDS       T01416                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100431735 (PDGFRA)
   04014 Ras signaling pathway
    100431735 (PDGFRA)
   04015 Rap1 signaling pathway
    100431735 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100431735 (PDGFRA)
   04020 Calcium signaling pathway
    100431735 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100431735 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100431735 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100431735 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100431735 (PDGFRA)
   04540 Gap junction
    100431735 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100431735 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431735 (PDGFRA)
   05206 MicroRNAs in cancer
    100431735 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100431735 (PDGFRA)
   05231 Choline metabolism in cancer
    100431735 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100431735 (PDGFRA)
   05218 Melanoma
    100431735 (PDGFRA)
   05215 Prostate cancer
    100431735 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100431735 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100431735 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100431735 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100431735 (PDGFRA)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100431735 (PDGFRA)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100431735 (PDGFRA)
CD molecules [BR:pon04090]
 Proteins
  100431735 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 100431735
NCBI-ProteinID: XP_009238298
Ensembl: ENSPPYG00000014767
UniProt: H2PDE4
LinkDB
Position
4
AA seq 1089 aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGENEVSWQYP
MSEEENSNVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDL
VDDHHGSTGGQMVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEVHPRD
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccggcgttcctggtcttaggctgtcttctcacagggctgagccta
atcctctgccagctttcattaccctctatccttccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagaatgaagtgagctggcagtacccc
atgtctgaagaagagaactccaatgtggaaatcagaaatgaagaaaacaacagtggcctt
tttgtgacggtcttggaagtgagcagtgcctcggcggcccacacagggttgtacacttgc
tattacaaccacactcagacagaagagaatgagcttgaaggcaggcacatttacatctat
gtgccagacccagatgtagcctttgtacctctaggaatgacggattatttagtcatcgtg
gaggatgatgattctgccatcataccttgtcgcacaactgatcccgagactcctgtaacc
ttacacaacagtgagggagtggtacctgcctcctacgacagcagacagggctttaatggg
accttcactgtagggccctatatctgtgaggccaccgtcaaaggaaagaagttccagacc
atcccatttaacgtttatgctttaaaagcaacatcagagctggatctagaaatggaagct
cttaaaaccgtgtataagtcaggggaaacgattgtggtcacctgtgctgtttttaacaat
gaggtggttgaccttcaatggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaagaaatcaaagtcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggctaccagggaggtcaaa
gaaatgaagaaagtcactatttctgtccatgagaaagggttcattgaaatcaaacccacc
ttcagccagttggaagctgtcaacctgcatgaagtcaaacattttgttgtagaggtgcgg
gcctacccacctcccaggatatcctggctgaaaaacaatctgactctgattgaaaatctc
actgagatcaccactgatgtggaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgtgctaaggaagaagacagtggccattatacaattgtagctcaaaatgaagat
gctgtgaagagctatacttttgaactgttaactcaagttccttcatcaattctggacttg
gtcgatgatcaccatggctcaactgggggacagatggtgagatgcacagctgaaggcacg
ccgcttcctgatattgagtggatgatatgcaaggatattaagaaatgtaataatgaaact
tcctggacgattttggccaacaatgtctcaaacatcatcacggaggtccacccccgagac
aggagtaccgtggagggccgtgtgactttcgccaaagtggaggagaccattgcggtgcga
tgcctggctaagaatctccttggagctgagaaccgagagctgaagctggtggctcccacc
ctgcgttctgaactcacggtggctgctgcagtcctggtgctgttggtgattgtgatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagcccggatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcaagatgggagtttccaagagatggactagtgcttggtcgggtcttgggg
tctggagcatttgggaaggtggttgaaggaacagcctatggattaagtcggtcccaacct
gtcatgaaagttgcagtgaagatgctaaaacccacggccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacatttgaacattgtaaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacggagtactgcttctatgga
gatttggtcaactatttgcataagaatagggatagcttcctgagccaccacccagagaag
ccaaagaaagagctggatatctttggattgaaccctgctgatgaaagcacacggagctat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgatactaca
cagtatgtccccatgctagaaagaaaagaggtttctaaatattccgacatccagagatca
ctctatgatcgtccagcctcatataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggccttactttattggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgtgatctggct
gctcgcaacgtcctcctggcacaaggaaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcaaactatgtgtcaaaaggcagtacctttctgcccgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagtgatgtctggtct
tacggcattctgctctgggagatcttttcccttggtggcaccccttaccccggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggctaagcctgaccat
gctaccagtgaagtctacgagatcatggtgaaatgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaaaattcacctggacttcctgaagagtgaccatcctgctgtggcacgcatg
cgtgtggactcagacaatgcgtacattggtgtcacctacaaaaacgaggaagacaagctg
aaggactgggagggtggtctggatgagcagagactgagcgctgacagtggctacatcatt
cctctgcctgacattgaccctgtccctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccattgagacgggttccagcagttccaccttcatc
aagagagaggacgagaccattgaagacatcgacatgatggacgacatcggcatagactct
tcagacctggtagaagacagcttcctgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100459280
Entry
100459280         CDS       T01416                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X2
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon05160  Hepatitis C
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459280 (EGFR)
   04012 ErbB signaling pathway
    100459280 (EGFR)
   04014 Ras signaling pathway
    100459280 (EGFR)
   04015 Rap1 signaling pathway
    100459280 (EGFR)
   04630 JAK-STAT signaling pathway
    100459280 (EGFR)
   04066 HIF-1 signaling pathway
    100459280 (EGFR)
   04068 FoxO signaling pathway
    100459280 (EGFR)
   04020 Calcium signaling pathway
    100459280 (EGFR)
   04072 Phospholipase D signaling pathway
    100459280 (EGFR)
   04151 PI3K-Akt signaling pathway
    100459280 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100459280 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100459280 (EGFR)
   04520 Adherens junction
    100459280 (EGFR)
   04540 Gap junction
    100459280 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459280 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100459280 (EGFR)
   04915 Estrogen signaling pathway
    100459280 (EGFR)
   04921 Oxytocin signaling pathway
    100459280 (EGFR)
   04926 Relaxin signaling pathway
    100459280 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100459280 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459280 (EGFR)
   05206 MicroRNAs in cancer
    100459280 (EGFR)
   05205 Proteoglycans in cancer
    100459280 (EGFR)
   05230 Central carbon metabolism in cancer
    100459280 (EGFR)
   05231 Choline metabolism in cancer
    100459280 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100459280 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100459280 (EGFR)
   05212 Pancreatic cancer
    100459280 (EGFR)
   05225 Hepatocellular carcinoma
    100459280 (EGFR)
   05226 Gastric cancer
    100459280 (EGFR)
   05214 Glioma
    100459280 (EGFR)
   05218 Melanoma
    100459280 (EGFR)
   05219 Bladder cancer
    100459280 (EGFR)
   05215 Prostate cancer
    100459280 (EGFR)
   05213 Endometrial cancer
    100459280 (EGFR)
   05224 Breast cancer
    100459280 (EGFR)
   05223 Non-small cell lung cancer
    100459280 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100459280 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100459280 (EGFR)
   05171 Coronavirus disease - COVID-19
    100459280 (EGFR)
   05163 Human cytomegalovirus infection
    100459280 (EGFR)
   05165 Human papillomavirus infection
    100459280 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100459280 (EGFR)
   01522 Endocrine resistance
    100459280 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100459280 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100459280 (EGFR)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100459280 (EGFR)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100459280 (EGFR)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100459280 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100459280 (EGFR)
  Exosomal proteins of bladder cancer cells
   100459280 (EGFR)
SSDB
Motif
Pfam: Recep_L_domain GF_recep_IV Furin-like
Other DBs
NCBI-GeneID: 100459280
NCBI-ProteinID: XP_002817983
LinkDB
Position
7
AA seq 628 aa
MRSSRTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGS
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgcgatcctcccggacggccggggcagcgctcctggcgctgctagctgcgctctgcccg
gcgagtcgggctctggaggaaaagaaagtttgccaaggcacgagtaacaagctcacgcag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatctggaaattacctatgtacagaggaattatgatctttccttcttaaag
accatccaggaggtggctggttatgtcctcatcgccctcaacacagtggagcggattcct
ttggaaaacctgcagatcatcagaggaaatatgtactatgaaaattcctatgccttagca
gtcttatctaactatgatgcaaataaaaccggactaaaggagctgcccatgagaaattta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagcgactttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaagctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctct
gggcgctgccgcggcaaatcccccagtgactgctgccacaaccagtgtgccgctggctgc
acgggcccccgggagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctctacaaccccaccacataccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgtggggccgacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaacggaata
ggtattggtgaatttaaagacacactctccataaatgctacgaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacacactccacctctggatccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggacctccatgctttt
gagaacctagaaatcatacgcggcaggaccaagcaacatgggcagttttctcttgcagtc
gtcagcctgaacataacatccttgggattacgctccctcaaggagataagcgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccggtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacaggccaggtctgccatgccttgtgctcccccgagggctgctggggcccggagccc
agggactgcgtctcctgccggaatgtcagccgaggcagagaatgcgtggacaagtgcaac
attctggagggcgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gaatgcctgccccaggccatgaacatcacctgcacgggacggggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccggcaggagtcatg
ggagaaaacaacaccctggtctggaagtacgcagacgccggccacgtgtgccacctgtgc
catccaaactgcacctacgggtcctaa

KEGG   Pongo abelii (Sumatran orangutan): 100460001
Entry
100460001         CDS       T01416                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100460001 (PDGFRB)
   04014 Ras signaling pathway
    100460001 (PDGFRB)
   04015 Rap1 signaling pathway
    100460001 (PDGFRB)
   04630 JAK-STAT signaling pathway
    100460001 (PDGFRB)
   04020 Calcium signaling pathway
    100460001 (PDGFRB)
   04072 Phospholipase D signaling pathway
    100460001 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    100460001 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100460001 (PDGFRB)
   04540 Gap junction
    100460001 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460001 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460001 (PDGFRB)
   05206 MicroRNAs in cancer
    100460001 (PDGFRB)
   05230 Central carbon metabolism in cancer
    100460001 (PDGFRB)
   05231 Choline metabolism in cancer
    100460001 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    100460001 (PDGFRB)
   05218 Melanoma
    100460001 (PDGFRB)
   05215 Prostate cancer
    100460001 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100460001 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100460001 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100460001 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100460001 (PDGFRB)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100460001 (PDGFRB)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100460001 (PDGFRB)
CD molecules [BR:pon04090]
 Proteins
  100460001 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set C1-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 100460001
NCBI-ProteinID: XP_002816120
Ensembl: ENSPPYG00000015943
UniProt: A0A663D6Y7 H2PH25
LinkDB
Position
5
AA seq 1106 aa
MRLLGAMPALALKGQLLLLPLLLLLEPQVSQGLVITPPGPELVLNVSSTFVLTCSGSAPV
VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLEPDERKRLYIFV
PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDIALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQV
EPEPELEQLPDSGCPAPRVEAEDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgcggcttctgggtgcgatgccagctctggccctcaaaggccagctgctgttgctgccc
ctcctgttactgctggaaccacaggtctctcagggcctggtcatcacacccccagggcca
gagcttgtcctcaatgtctccagcaccttcgttctgacctgctctggttcagctccggtg
gtgtgggaacggatgtcccaggagcccccacaggaaatggccaaggcccaggatggcacc
ttctccagcgtgctgacactgaccaacctcactgggctagacacgggagaatacttttgc
acccacaatgactcccgtggactggagcctgatgagcggaaacggctctacatctttgtg
ccagatcccactgtgggcttcctccctaatgatgccgaggaactattcatctttctcacg
gaaataactgagatcaccattccatgccgagtaacagacccacagctggtggtgacactg
cacgagaagaaaggggacattgcactgcctgtcccctatgatcaccaacgtggcttttct
ggtatctttgaggacagaagctacatctgcaaaaccaccattggggacagggaggtggat
tccgatgcctactatgtctacagactccaggtgtcatctatcaacgtctctgtgaacgca
gtgcagactgtggtccgccagggtgagaacatcaccctcatgtgcattgtgatcgggaat
gaggtggtcaacttcgagtggacatacccccgcaaagaaagtgggcggctggtggagccg
gtgaccgacttcctcttggatatgccttaccacatccgctccatcctgcacatccccagt
gccgagttagaagactcggggacctacacctgcaatgtgacggagagtgtgaatgaccat
caggatgaaaaggccatcaacatcaccgtggttgagagtggctacgtgcggctcctggga
gaagtgggcacactgcaatttgctgagctgcatcggagccggacactgcaggtagtattc
gaggcctacccaccgcccaccgtcctgtggtttaaagacaaccgcaccctgggcgactcc
agcgctggcgagatcgccctgtccacgcgcaacgtgtcggagacccggtatgtgtcagag
ctgacactggttcgcgtgaaggtggcagaggctggccactacaccatgcgggccttccat
gaggacgctgaggtccagctctccttccagctacagatcaatgtccctgtccgagtgctg
gagctaagtgagagccaccctgacagcggggaacagacagtccgctgtcgtggccggggc
atgccccagccgaacatcatctggtccgcctgcagagacctcaaaaggtgtccacgcgag
ctgccgcccacgctgctggggaacagttccgaagaggagagccagctggagacgaacgtg
acgtactgggaggaggagcaggagtttgaggtggtgagcacactgcgtctgcagcacgtg
gatcggccgctgtcggtgcgctgcacgctgcgcaacgctgtgggccaggacacgcaggag
gtcatcgtggtgccacactccttgccctttaaggtggtggtgatctcagccatcctggcc
ctggtggtgctcaccatcatctcccttatcatcctcatcatgctttggcagaagaagcca
cgttacgagatccgatggaaggtgattgagtctgtgagctctgacggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacgtgggagctgccgcgggaccagctt
gtgctgggacgcaccctcggctctggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggccacgatgaaagtggccgtcaagatgcttaaatccacagcc
cgcagcagtgagaagcaagcccttatgtcggagctgaagatcatgagtcaccttgggccc
cacctgaacgtggtcaacctgttgggggcctgcaccaaaggaggacccatctatatcatc
actgagtactgccgctacggagacctggtggactacctgcaccgcaacaaacacaccttc
ctgcagcaccactctgacaagcgccgcccgcccagcgcggagctctacagcaatgcactg
cccgttgggctccccctgcccagccatgtgtccttgactggggagagcgacggtggctac
atggacatgagcaaggacgagtcggtggactacgtacccatgctggacatgaaaggagac
gtcaaatatgcagacatcgagtcctccaattacatggccccttacgataactacgttccc
tctgcccctgagaggacctgtcgggcaactttgatcaacgagtctccagtgctaagctac
atggacctcgtgggcttcagctaccaggtggccaatggcatggagtttctggcctccaag
aactgcgtccacagagacctggcggctaggaacgtgctcatctgtgaaggcaagctggtc
aagatctgtgactttggcctggctcgagacatcatgcgggactcgaattacatctccaaa
ggcagcacctttttgcctttgaagtggatggctccggagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcaccttgggt
ggcaccccttacccagagctgcccatgaatgaacagttctacaatgccatcaaacggggt
taccgcatggcccagcctgcccatgcctccgatgagatctatgagatcatgcagaagtgc
tgggaagagaagtttgagattcggccccccttctcccagctggtgctgcttctcgagaga
ctgttgggcgaaggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagt
gaccacccagccatccttcggtcccaggcccgcttgcctgggttccatggcctccgatct
cccctggacaccagctccgtcctctatactgccgtgcagcccaatgagggtgacaacgac
tatatcatccccctgcccgaccccaaacccgaggttgctgacgagggcccactggagggt
tcccccagcctagccagctccaccctgaatgaagtcaacacctcctcaaccatctcctgt
gacagccccctggagccccaggatgaaccagagccagagccccagcttgagctccaggtg
gagccagagccggagctggaacagctgccggattcagggtgccctgcgcctcgggtggaa
gcagaggacagcttcctgtag

DBGET integrated database retrieval system