KEGG   Pongo abelii (Sumatran orangutan): 100137034
Entry
100137034         CDS       T01416                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2 precursor
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100137034 (WNT2)
   04390 Hippo signaling pathway
    100137034 (WNT2)
   04150 mTOR signaling pathway
    100137034 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100137034 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100137034 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100137034 (WNT2)
   05205 Proteoglycans in cancer
    100137034 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100137034 (WNT2)
   05226 Gastric cancer
    100137034 (WNT2)
   05217 Basal cell carcinoma
    100137034 (WNT2)
   05224 Breast cancer
    100137034 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100137034 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    100137034 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100137034 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100137034 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100137034 (WNT2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100137034 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100137034
NCBI-ProteinID: NP_001162068
Ensembl: ENSPPYG00000017938
UniProt: Q2IBE2 A0A2J8UPD4
LinkDB
Position
7
AA seq 360 aa
MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccctctcggtggaatctggctctggctccctctgctcttgacctggctcacc
cccgaggtcaactcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgcgataatgtgccaggcctggtgagcagccagcggcagctgtgtcaccgacatccagat
gtgatgcgtgccattagccagggcgtggccgagtggacagcggaatgccagcaccagttc
cgccagcaccgctggaattgcaacaccctggacagggatcacagcctctttggcagggtc
ctactccgaagtagtcgggaatctgcctttgtttatgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggtgaagtaaaatcctgttcctgtgatccaaag
aagatgggaagcgccaaggacagcaaaggcatttttgattggggtggctgcagtgataac
attgactatgggatcaaatttgcccgcgcatttgtggatgcaaaggaaaggaaaggaaag
gatgccagagccctgatgaatcttcacaacaacagagctggcaggaaggctgtaaagcgg
ttcttgaaacaagagtgcaagtgccacggggtgagcggctcatgtactctcaggacatgc
tggctggccatggccgacttcaggaaaacaggcgattatctctggaggaagtacaatggg
gccatccaggtggtcatgaaccaggatggcacaggtttcactgtggctaacgagaggttt
aagaagccaacaaaaaatgacctcgtgtattttgagaattctccagactactgtatcagg
gaccgagaggcaggctccctgggtacagcaggccgtgtgtgcaacctgacttctcggggc
atggacagctgcgaagtcatgtgctgtgggagaggctacgacacctcccatgtcacccgg
atgaccaagtgtgggtgtaagttccactggtgctgcgccgtgcgctgtcaggactgcctg
gaagctctggacgtgcacacatgcaaggcccccaagaacgctgactggacaacccctaca
tga

KEGG   Pongo abelii (Sumatran orangutan): 100174132
Entry
100174132         CDS       T01416                                 

Gene name
WNT5B
Definition
(RefSeq) protein Wnt-5b precursor
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100174132 (WNT5B)
   04390 Hippo signaling pathway
    100174132 (WNT5B)
   04150 mTOR signaling pathway
    100174132 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100174132 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100174132 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    100174132 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174132 (WNT5B)
   05205 Proteoglycans in cancer
    100174132 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100174132 (WNT5B)
   05226 Gastric cancer
    100174132 (WNT5B)
   05217 Basal cell carcinoma
    100174132 (WNT5B)
   05224 Breast cancer
    100174132 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100174132 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    100174132 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100174132 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100174132 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100174132 (WNT5B)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100174132 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100174132
NCBI-ProteinID: NP_001127098
Ensembl: ENSPPYG00000004141
UniProt: Q5NVK2 A0A2J8S3M2
LinkDB
Position
12
AA seq 359 aa
MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTVDNASVFGRVMQIGSRETAFTYAV
SAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVKCKKCTEIVDQYICK
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcctagcctgctgctgctgttcacggctgctctgctgtccagctgggctcagcttctg
acagatgccaactcctggtggtcattagctttgaaccctgtgcagagacccgagatgttt
atcatcggtgcccagcccgtgtgcagtcagcttcccgggctctcccctggccagaggaag
ctgtgccaattgtaccaggagcacatggcctacataggggagggagccaagactggcatc
aaggaatgccagcaccagttccggcagcggcggtggaactgcagcacagtggacaacgcg
tctgtctttgggagagttatgcagataggtagccgagagaccgccttcacctatgcagtg
agcgccgcaggcgtggtgaacgccatcagccgggcctgccgcgagggcgagctctccacc
tgcggctgcagccggacggcgcggcccaaggacctgccccgggactggctgtggggtggc
tgtggggacaatgtggagtacggctaccgcttcgccaaggagttcgtggatgcccgggag
cgagagaagaactttgccaaaggatcggaggaacagggccgggtgctgatgaacctgcaa
aacaacgaggccggtcgcagggctgtgtataagatggcagacgtagcctgcaaatgccac
ggcgtctcggggtcctgcagcctcaagacctgctggctgcagctggccgagttccgcaag
gtcggggaccggctgaaggagaagtacgacagtgcggccgccatgcgcgtcacccgcaag
ggccggctggagctggtcaacagccgcttcacccagcccaccccggaggacctggtctac
gtggaccccagccccgactactgcctgcgcaacgagagcacgggctccctgggcacgcag
ggccgcctctgcaacaagacctcggagggcatggatggctgtgagctcatgtgctgcggg
cgcggctacaaccagttcaagagcgtgcaggtggagcgctgccactgcaagttccactgg
tgctgcttcgtcaagtgtaagaagtgcacggagatcgtggaccagtacatctgtaaatag

KEGG   Pongo abelii (Sumatran orangutan): 100431449
Entry
100431449         CDS       T01416                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100431449 (WNT3)
   04390 Hippo signaling pathway
    100431449 (WNT3)
   04150 mTOR signaling pathway
    100431449 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100431449 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100431449 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431449 (WNT3)
   05206 MicroRNAs in cancer
    100431449 (WNT3)
   05205 Proteoglycans in cancer
    100431449 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100431449 (WNT3)
   05226 Gastric cancer
    100431449 (WNT3)
   05217 Basal cell carcinoma
    100431449 (WNT3)
   05224 Breast cancer
    100431449 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100431449 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    100431449 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100431449 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100431449 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100431449 (WNT3)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100431449 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100431449
NCBI-ProteinID: XP_002827437
Ensembl: ENSPPYG00000008292
UniProt: A0A6D2W3S5 H2NTP4
LinkDB
Position
17
AA seq 355 aa
MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctcggtggcaccagggtcctc
gctggctacccaatttggtggtccctggccctgggccagcagtacacatctctgggctca
cagcccctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgagatcatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatagatgacagcctggccatc
tttgggcctgtccttgacaaagccacccgcgagtcggccttcgtgcacgccatcgcctcg
gccggcgtggccttcgccgtcacccgctcctgcgccgagggcacctccacgatttgcggc
tgtgactcgcatcataaggggccgcctggcgaaggctggaagtggggcggctgcagcgag
gacgctgacttcggggtgttagtgtccagggagttcgcggatgcgcgcgagaacaggccg
gacgcgcgctcggccatgaacaagcacaacaacgaggcgggccgcacgactatcctggac
cacatgcacctcaaatgcaagtgccacgggctgtcaggcagctgtgaggtgaagacctgc
tggtgggcgcagcctgacttccgtgccatcggcgacttcctcaaggacaagtatgacagc
gcctcggagatggtagtagagaagcaccgtgagtcccgaggctgggtggagaccctccgg
gccaagtactcgctcttcaagccacccaccgaaagggacctggtctactatgagaactcc
cccaacttttgtgagcctaacccagagacgggttcctttggcacaagggaccggacttgc
aatgtcacctcccacggcatcgatggctgcgatctgctctgctgtggccggggccacaac
acgaggacggagaagcggaaggaaaaatgccactgcatcttccactggtgctgctacgtc
agctgccaggagtgtattcgcatctacgacgtgcacacctgcaagtag

KEGG   Pongo abelii (Sumatran orangutan): 100436330
Entry
100436330         CDS       T01416                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04919  Thyroid hormone signaling pathway
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100436330 (WNT4)
   04390 Hippo signaling pathway
    100436330 (WNT4)
   04150 mTOR signaling pathway
    100436330 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100436330 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100436330 (WNT4)
   04916 Melanogenesis
    100436330 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    100436330 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100436330 (WNT4)
   05205 Proteoglycans in cancer
    100436330 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100436330 (WNT4)
   05226 Gastric cancer
    100436330 (WNT4)
   05217 Basal cell carcinoma
    100436330 (WNT4)
   05224 Breast cancer
    100436330 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100436330 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    100436330 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100436330 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100436330 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100436330 (WNT4)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100436330 (WNT4)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100436330
NCBI-ProteinID: XP_009232283
Ensembl: ENSPPYG00000001754
LinkDB
Position
1
AA seq 296 aa
MCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAI
SSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRER
SKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALK
EKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRT
CNKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtgcaagcggaacctggaagtcatggactcggtgcgccgcggtgcccaactggccatt
gaagagtgccagtaccagttccggaaccggcgctggaactgctccacgctcgactccctg
cccgtctttggcaaggtggtgacgcaagggactcgggaggcggccttcgtgtacgccatc
tcttcggcaggtgtggcctttgcagtgacgcgggcgtgcagcagtggggagctggagaag
tgcggctgtgacaggacggtgcatggggtcagcccacagggcttccagtggtcaggatgc
tctgacaacatcgcctacggtgtggccttctcacagtcgtttgtggatgtgcgggagaga
agcaagggggcctcgtccagcagagccctcatgaacctccacaacaatgaggccggcagg
aaggccatcctgacacacatgcgggtggaatgcaagtgccacggggtgtcaggctcctgt
gaggtaaagacgtgctggcgagccgtgccgcccttccgccaggtgggtcacgcactgaag
gagaagtttgatggtgccactgaggtggagccacgccgcgtgggctcctccagggcactg
gtgccacgcaacgcacagttcaagccgcacacagatgaggacctggtgtacttggagcct
agccccgacttctgcgagcaggacatgcgcagtggcgtgctgggcacaaggggccgcaca
tgcaacaagacgtccaaggccatcgacggctgtgagctgctgtgctgtggccgcggcttc
cacactgcgcaggtggagctggctgaacgctgcagctgcaaattccactggtgctgcttc
gtcaagtgccggcagtgccagcggcttgtggagttgcacacgtgccgatga

KEGG   Pongo abelii (Sumatran orangutan): 100440643
Entry
100440643         CDS       T01416                                 

Gene name
WNT6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100440643 (WNT6)
   04390 Hippo signaling pathway
    100440643 (WNT6)
   04150 mTOR signaling pathway
    100440643 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100440643 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100440643 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440643 (WNT6)
   05205 Proteoglycans in cancer
    100440643 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100440643 (WNT6)
   05226 Gastric cancer
    100440643 (WNT6)
   05217 Basal cell carcinoma
    100440643 (WNT6)
   05224 Breast cancer
    100440643 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100440643 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    100440643 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100440643 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100440643 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100440643 (WNT6)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100440643 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100440643
NCBI-ProteinID: XP_024099299
LinkDB
Position
2B
AA seq 365 aa
MLPPAPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGD
EKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgccgcccgcaccctcacgtctcgggctgctgctgctgctgctcctgtgcccggcg
cacgtcggcggactgtggtgggctgtgggcagccccttggttatggaccctaccagcatc
tgcaggaaggcacggcggctggccgggcggcaggccgagttgtgccaggctgagccggaa
gtggtggcagagctagcccggggcgcccggctcggggtgcgagagtgccagttccagttc
cgcttccgccgctggaactgctccagccacagcaaggcctttggacgcatcctgcaacag
gacattcgggagacggccttcgtgtttgctattactgcggcgggcgccagccacgctgtc
acgcaggcctgttctatgggcgagctgctgcagtgcggctgccaggcgccccgcgggcgg
gcccctccccggccctccggcctgcccggcacccccggaccccctggccccgcgggctcc
ccggaaggcagcgccgcctgggagtggggaggctgcggcgacgacgtggacttcggggac
gagaagtcgaggctctttatggacgcgcggcacaagcggggacgcggagacatccgcgcg
ttggtgcaactgcacaacaacgaggcgggccggctggccgtgcggagccacacgcgcacc
gagtgcaaatgccacgggctgtcgggatcatgcgcgctgcgcacctgctggcagaagctg
cctccgtttcgcgaggtgggcgcgcggctgctggagcgcttccacggcgcctcacgcgtc
atgggcaccaacgacggcaaggccctgctgcccgccgtccgcacgctcaagccgccgggc
cgagcggacctcctctacgccgccgattcgcccgacttctgcgcccccaaccgacgcacc
ggctcccccggcacgcgcggtcgcgcctgcaatagcagcgccccggacctcagcggctgc
gacctgctgtgctgcggccgcgggcaccgccaggagagcgtgcagctcgaagagaactgc
ctgtgccgcttccactggtgctgcgtagtacagtgccaccgctgccgtgtgcgcaaggag
ctcagcctctgcctctga

KEGG   Pongo abelii (Sumatran orangutan): 100440744
Entry
100440744         CDS       T01416                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100440744 (WNT10B)
   04390 Hippo signaling pathway
    100440744 (WNT10B)
   04150 mTOR signaling pathway
    100440744 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100440744 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100440744 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440744 (WNT10B)
   05205 Proteoglycans in cancer
    100440744 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100440744 (WNT10B)
   05226 Gastric cancer
    100440744 (WNT10B)
   05217 Basal cell carcinoma
    100440744 (WNT10B)
   05224 Breast cancer
    100440744 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100440744 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    100440744 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100440744 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100440744 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100440744 (WNT10B)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100440744 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100440744
NCBI-ProteinID: XP_002823217
Ensembl: ENSPPYG00000004474
UniProt: A0A2J8SYS8
LinkDB
Position
12
AA seq 389 aa
MLEEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSSPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSLLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctggaggagccccggccgcggcctccgccctcgggcctcgcgggtctcctgttcctg
gccttgtgcagtcgggctctaagcaatgagattctgggcctgaagttgcctggcgagccg
ccgctgacggccaacaccgtgtgcttgacgctgtccggcctaagcaagcggcagctaggc
ctgtgcctgcgcaaccccgacgtgacggcgtccgcgcttcagggtctgcacatcgcggtc
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctccgcgcttgagggcggc
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgagaaagtgctttttcc
ttctccatgctggctgctggggtcatgcacgcagtagccacggcctgcagcctgggcaag
ctggtgagctgtggctgtggctggaagggcagtggtgagcaggatcggctgagggccaaa
ctgctgcagctgcaggcactgtcccgaggcaagagtttcccccactctctgcccagccct
ggccctggctcaagccccagccctggcccccaggacacatgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcacgaatgcgaatccacaacaacagggtggggcgccaggtggtaact
gaaaacctgaagcggaaatgcaagtgtcatggcacgtcaggcagctgccagttcaagaca
tgctggagggcggccccagagttccgggcagtgggggcggcgttgagggagcggctgggc
cgggccatcttcattgatacccacaaccgcaattctggagccttccagccccgtctgcgt
ccccgtcgcctctcaggagagctggtctactttgagaagtctcctgacttctgtgagcga
gaccccactatgggctccccagggacaaggggccgggcctgcaacaagaccagcctcctg
ctggatggctgtggcagcctgtgctgtggccgtgggcacaatgtgctccggcagacacga
gttgagcgctgccattgccgcttccactggtgctgctatgtgctgtgtgatgagtgcaag
gttacagagtgggtgaatgtgtgtaagtga

KEGG   Pongo abelii (Sumatran orangutan): 100441013
Entry
100441013         CDS       T01416                                 

Gene name
WNT10A
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100441013 (WNT10A)
   04390 Hippo signaling pathway
    100441013 (WNT10A)
   04150 mTOR signaling pathway
    100441013 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100441013 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100441013 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100441013 (WNT10A)
   05205 Proteoglycans in cancer
    100441013 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100441013 (WNT10A)
   05226 Gastric cancer
    100441013 (WNT10A)
   05217 Basal cell carcinoma
    100441013 (WNT10A)
   05224 Breast cancer
    100441013 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100441013 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    100441013 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100441013 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100441013 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100441013 (WNT10A)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100441013 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 100441013
NCBI-ProteinID: XP_024099295
LinkDB
Position
2B
AA seq 417 aa
MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTV
CLTLPGLSRRQTEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLI
RPHNRNSGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctccgaccccagccccagccgcggcca
gcgctctgggtgctcctgttcttcctactgctgctggctgctgccatgcccaggtcagca
cccaatgacattctggacctccgcctccccccggagcccgtgctcaatgccaacacagtg
tgcctaacattgccaggcctgagccggcggcagacggaagtatgtgtgcgtcaccctgat
gtggctgcctcagccatacagggcatccagatcgccatccacgaatgccaacaccaattc
agggaccagcgctggaactgctcaagcctggagactcgcaacaagatcccctatgagagt
cccatcttcagcagaggtttccgagagagcgcttttgcctacgccatcgcggcagctggt
gtggtgcacgccgtgtccaatgcgtgtgccctgggcaaactgaaggcctgtggctgtgat
gcgtcccggcgaggggacgaggaggccttccgaaggaagctgcaccgcttacaactggac
gcactgcagcgtggtaagggcctgagccatggggtcccggaacacccagccctgcccaca
gccagcccaggcctgcaggactcctgggagtggggtggctgcagccccgacatgggcttc
ggggaacgcttctctaaggactttctggactcccgggagcctcacagagacatccacgcg
agaatgaggcttcacaacaaccgagttgggaggcaggcagtgatggagaacatgcggcgg
aagtgtaagtgccacggcacgtcaggcagctgccagctcaagacgtgctggcaggtgacg
cccgagttccgcaccgtgggggcgctgctgcgcagccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacagcggccagctggagccgggcccagcgggggcaccctcgccg
gctccgggcgctcccgggccgcgccgacgggccagccccgccgacctggtctacttcgaa
aagtcgcccgacttctgcgagcgcgagccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaagagcagcgccggctcggatggctgcggcagcatgtgctgcggccgtggc
cacaacatcctgcgccagacgcgcagcgagcgctgccactgccgcttccactggtgctgc
ttcgtggtctgcgaagagtgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Pongo abelii (Sumatran orangutan): 100441147
Entry
100441147         CDS       T01416                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100441147 (WNT7A)
   04390 Hippo signaling pathway
    100441147 (WNT7A)
   04150 mTOR signaling pathway
    100441147 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100441147 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100441147 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100441147 (WNT7A)
   05205 Proteoglycans in cancer
    100441147 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100441147 (WNT7A)
   05226 Gastric cancer
    100441147 (WNT7A)
   05217 Basal cell carcinoma
    100441147 (WNT7A)
   05224 Breast cancer
    100441147 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100441147 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    100441147 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100441147 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100441147 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100441147 (WNT7A)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100441147 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 100441147
NCBI-ProteinID: XP_024100838
LinkDB
Position
3
AA seq 349 aa
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcagtggtagctctgggcgcaagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcgcaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctctgcacttggagagcgcaccgtcttcgggaaggagctcaaagtgggg
agccgggaggctgcattcacctacgccatcattgccgccggcgtggcccacgccatcaca
gctgcctgtacccagggcaacctgagcgactgtggctgtgacaaagagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttgcacaataacgaggcaggccgaaagatcctggaggagaacatgaagctggaatgt
aagtgccacggcgtgtcaggctcgtgcaccaccaagacatgctggaccacactgccacag
tttcgggagctgggctacgtgctcaaggacaagtacaacgaggccgttcacgtggagcct
gtccgtgccagccgcaacaagcggcccaccttcctgaagatcaagaagccactgtcgtac
cgcaagcccatggacacggacctggtgtacatcgagaagtcgcccaactactgcgaagag
gacccggtgacaggcagtgtaggcacccagggccgcgcctgcaacaagacggctccccag
gccagcggctgtgacctcatgtgctgtgggcgtggctacaacacccaccagtacgcccgc
gtgtggcagtgcaactgtaagttccactggtgctgctatgtcaagtgcaacacgtgcagc
gagcgcacggagatgtacacgtgcaagtga

KEGG   Pongo abelii (Sumatran orangutan): 100441356
Entry
100441356         CDS       T01416                                 

Gene name
WNT1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100441356 (WNT1)
   04390 Hippo signaling pathway
    100441356 (WNT1)
   04150 mTOR signaling pathway
    100441356 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100441356 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100441356 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100441356 (WNT1)
   05205 Proteoglycans in cancer
    100441356 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100441356 (WNT1)
   05226 Gastric cancer
    100441356 (WNT1)
   05217 Basal cell carcinoma
    100441356 (WNT1)
   05224 Breast cancer
    100441356 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100441356 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    100441356 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100441356 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100441356 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100441356 (WNT1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100441356 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100441356
NCBI-ProteinID: XP_002823218
Ensembl: ENSPPYG00000004475
UniProt: A0A6D2XSG7 A0A2J8SYT3
LinkDB
Position
12
AA seq 370 aa
MGLWAQLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggctctgggcgcagttgcctggctgggtttctgctacgctgctgctagcgctggcc
gctctgcccgcagccctggctgccaacagcagtggccgatggtggggtattgtgaacgta
gcctcctccacgaacctgctgacggactccaagagtctgcaactggtacttgagcccagt
ctgcagctgttgagccgcaaacagcggcgtctgatacgccaaaatccggggatcctgcac
agcgtgagtggggggctgcagagtgccgtgcgcgagtgcaagtggcagttccggaatcgc
cgctggaactgtcccactgctccagggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgagaaacggcgtttatcttcgctatcacctccgccggggtcacccattcggtggcg
cgctcctgctcagagggttccatcgaatcctgcacgtgtgactaccggcggcgcggcccc
gggggccccgactggcactgggggggctgcagcgacaacattgacttcggccgcctcttc
ggccgggagttcgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcaggccgtacgaccgtattctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggctcgtgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgatgtgctgcgcgaccgcttcgacggcgcctcgcgcgtcctctacggcaac
cgcggcagcaaccgcgcttcgcgtgcggagctgctgcgcctggagccggaagacccggcc
cacaaaccgccctccccccacgacctcgtctacttcgagaaatcgcccaacttctgcacg
tacagcggacgcctgggtacagcgggcacggcagggcgcgcctgtaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgcggcaggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

KEGG   Pongo abelii (Sumatran orangutan): 100443554
Entry
100443554         CDS       T01416                                 

Gene name
WNT11
Definition
(RefSeq) protein Wnt-11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100443554 (WNT11)
   04390 Hippo signaling pathway
    100443554 (WNT11)
   04150 mTOR signaling pathway
    100443554 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100443554 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100443554 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100443554 (WNT11)
   05205 Proteoglycans in cancer
    100443554 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100443554 (WNT11)
   05226 Gastric cancer
    100443554 (WNT11)
   05217 Basal cell carcinoma
    100443554 (WNT11)
   05224 Breast cancer
    100443554 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100443554 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    100443554 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100443554 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100443554 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100443554 (WNT11)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100443554 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100443554
NCBI-ProteinID: XP_002822307
Ensembl: ENSPPYG00000003696
UniProt: H2NEQ1 A0A6D2X0R5
LinkDB
Position
11
AA seq 354 aa
MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgcgaggcgctgctcttcgccctggcgctccagaccggc
gtgtgctatggcatcaagtggctggcgctgtccaagacaccatcggccctggcactgaac
cagacgcaacactgcaagcagctggagggcctggtgtctgcacaggtgcagctgtgccgc
agcaacctggagctcatgcacacggtggtgcacgccgcccgcgaggtcatgaaggcctgt
cgccgggcctttgccgacatgcgctggaactgctcctccattgagctcgcccccaactat
ttgcttgacctggagagagggacccgggagtcggccttcgtgtatgcgctgtcggccgcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgcccggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgtgcctctctggaaatgaagtgtaagtgccatggggtgtctggctcctgctccatc
cgcacctgctggaaggggctgcaggagctgcaggatgtggctgctgacctcaagacccga
tacctgtcggccaccaaggtagtgcaccgacccatgggcacccgcaagcacctggtgccc
aaggacctggatatccggcctgtgaaggactcggagctcgtctatctgcagagctcacct
gacttctgcatgaagaatgagaaggtgggctcccacgggacacaagacaggcagtgcaac
aagacatccaacggaagcgacagctgcgatcttatgtgctgcgggcgtggctacaacccc
tacacagaccgcgtggtcgagcggtgccactgtaagtaccactggtgctgctatgtcacc
tgccgcaggtgtgagcgtaccgtggagcgctatgtctgcaagtga

KEGG   Pongo abelii (Sumatran orangutan): 100447525
Entry
100447525         CDS       T01416                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a isoform X1
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100447525 (WNT5A)
   04390 Hippo signaling pathway
    100447525 (WNT5A)
   04150 mTOR signaling pathway
    100447525 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100447525 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100447525 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    100447525 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447525 (WNT5A)
   05205 Proteoglycans in cancer
    100447525 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100447525 (WNT5A)
   05226 Gastric cancer
    100447525 (WNT5A)
   05217 Basal cell carcinoma
    100447525 (WNT5A)
   05224 Breast cancer
    100447525 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100447525 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100447525 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100447525 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100447525 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100447525 (WNT5A)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100447525 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100447525
NCBI-ProteinID: XP_002813669
Ensembl: ENSPPYG00000013781
UniProt: A0A2J8T110
LinkDB
Position
3
AA seq 380 aa
MKKSVGILSPGVALGMAGSAMSSKFFLMALAVFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagtccgttggaatattaagcccaggagttgctttggggatggctggaagtgca
atgtcttccaaattcttcctaatggctttggccgtgtttttctccttcgcccaggttgta
attgaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatattataggagcacagcctctctgcagccaactggcaggactttctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcaatacatcggagaaggcgcaaagacaggc
atcaaagaatgccagtatcaattccgacaccgaaggtggaactgcagcactgtggacaac
acctctgtttttggcagggtgatgcagataggcagccgcgagacggccttcacatacgcg
gtgagcgcagcaggggtggtgaacgccatgagccgggcgtgccgcgagggcgagctgtcc
acctgcggctgcagccgcgccgcgcgacccaaggacctgccgcgggactggctctggggc
ggctgcggcgacaacatcgactatggctaccgctttgccaaggagttcgtggacgcccgc
gagcgggagcgcatccacgccaagggctcctacgagagtgctcgcatcctcatgaacctg
cacaacaacgaggcgggccgcaggacggtgtacaacctggctgatgtggcctgcaagtgc
catggggtgtccggctcatgtagcctgaagacatgctggctgcagctggcggacttccgc
aaggtgggtgatgccctgaaggagaagtatgacagcgcggcggccatgcggctcaacagc
cggggcaagctggtgcaggtcaacagccgcttcaactcgcccaccacacaagacctggtc
tacattgaccccagccctgactactgcgtgcgcaatgagagcaccggctcgctgggcacg
cagggccgcctgtgcaacaagacgtcggagggcatggatggctgtgagctcatgtgctgc
ggccgtggctacgaccagttcaagaccgtgcagacggagcgctgccactgcaagttccac
tggtgctgctacgtcaagtgcaagaagtgcacagagatcgtggaccagtttgtgtgcaag
tag

KEGG   Pongo abelii (Sumatran orangutan): 100448240
Entry
100448240         CDS       T01416                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a isoform X1
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100448240 (WNT3A)
   04390 Hippo signaling pathway
    100448240 (WNT3A)
   04150 mTOR signaling pathway
    100448240 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100448240 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100448240 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100448240 (WNT3A)
   05206 MicroRNAs in cancer
    100448240 (WNT3A)
   05205 Proteoglycans in cancer
    100448240 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100448240 (WNT3A)
   05226 Gastric cancer
    100448240 (WNT3A)
   05217 Basal cell carcinoma
    100448240 (WNT3A)
   05224 Breast cancer
    100448240 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100448240 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    100448240 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100448240 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100448240 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100448240 (WNT3A)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100448240 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100448240
NCBI-ProteinID: XP_002809409
Ensembl: ENSPPYG00000000150
UniProt: H2N3H7
LinkDB
Position
1
AA seq 385 aa
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRIYDVHTCKNPGSRAGN
SAHQPPHPQPPVRFHPPLCRAGKVP
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggccccgctcggatacttcttactcctctgcagcctgaagcaggctctgggcagctac
ccgatctggtggtcgctggctgttgggccacagtattcctccctgggctcgcagcccatc
ctgtgtgccagcatcccgggcctggtccccaagcagctccgcttctgcaggaactacgtg
gagatcatgcccagcgtggccgagggcatcaagattggcatccaggagtgccagcaccag
ttccgcggccgccggtggaactgcaccaccgtccatgacagcctggccatcttcgggcct
gtgctggacaaagctaccagggagtcagcctttgtccacgccattgcctcagccggtgtg
gcctttgcggtgacacgctcatgtgcagaaggcacggccgccatctgtggctgcagcagc
cgccaccagggctcaccaggcaagggctggaagtggggtggctgtagcgaggacatcgag
tttggtgggatggtgtctcgggagttcgccgacgcccgggagaaccggccagatgcccgc
tcagccatgaaccgccacaacaacgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacatgctggtggtcg
caacccgacttccgcgccatcggtgacttcctcaaggacaagtacgacagcgcctcggag
atggtggtggagaagcaccgggagtcccgcggctgggtggagaccctgcggccgcgctac
acctacttcaaggtgcccacggagcgcgacctggtctactacgaggcctcgcccaacttc
tgcgagcccaaccccgagacgggctccttcggcacgcgcgaccgcacctgcaacgtcagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccgcggccacaacgcgcgagcc
gagcggcgccgggagaagtgccgctgcgtgttccactggtgctgctacgtcagctgccag
gagtgcacgcgcatctacgacgtgcacacctgcaagaatcccggctccagagcagggaat
tcagcccaccagccccctcatccccaaccccctgtaaggttccatccacccctgtgtcga
gctgggaaggttccatga

KEGG   Pongo abelii (Sumatran orangutan): 100448766
Entry
100448766         CDS       T01416                                 

Gene name
WNT8A
Definition
(RefSeq) protein Wnt-8a isoform X1
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100448766 (WNT8A)
   04390 Hippo signaling pathway
    100448766 (WNT8A)
   04150 mTOR signaling pathway
    100448766 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100448766 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100448766 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100448766 (WNT8A)
   05205 Proteoglycans in cancer
    100448766 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100448766 (WNT8A)
   05226 Gastric cancer
    100448766 (WNT8A)
   05217 Basal cell carcinoma
    100448766 (WNT8A)
   05224 Breast cancer
    100448766 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100448766 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    100448766 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100448766 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100448766 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100448766 (WNT8A)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100448766 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100448766
NCBI-ProteinID: XP_024103254
LinkDB
Position
5
AA seq 386 aa
MLCYIQCLCLVSPFPTLTPCQGGPHCLIPIHLCLPFSLFGRSVNNFLITGPKAYLTYTTS
VALGAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYIITK
NCSMGDFENCGCDGSKNGKTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNL
HNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLADFREMGDYLKAKYDQALKIEMDK
RQLRAGNSAEGHWVPAQAFLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNT
SRWERRSCGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKCDQCRHVTMSNPAVLLGIR
RIEAKNERVLFRLLKISLWLQIYADK
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgctgtgctacattcagtgcctctgcctggtaagtcctttcccaaccctcactccttgc
caaggaggcccccattgtctcatccccattcacctctgcctccctttttctctttttggt
aggtcagtgaacaatttcctgataacaggtcccaaggcctatctgacctatacgactagc
gtggccttaggtgcccagagtggcatcgaggagtgcaagttccagtttgcttgggaacgc
tggaactgccctgaaaatgctcttcagctctccacccacaacaggctgagaagtgctacc
agagagacttccttcatacatgctatcagctctgctggagtcatgtacatcatcaccaag
aactgtagcatgggtgacttcgaaaactgtggctgtgatgggtcaaaaaatggaaaaaca
ggaggccatggctggatctggggaggctgcagcgacaatgtggaatttggggaaaggatc
tccaaactctttgtggacagtttggagaagggaaaggatgccagagccctgatgaatctt
cacaacaacagggccggcagactggcggtgagagctaccatgaaaaggacatgcaaatgt
catggcatctctgggagctgcagcatacagacgtgctggctgcagctggctgacttccgg
gagatgggagactacctaaaggccaagtacgaccaggcgctgaaaattgaaatggataag
cggcagctgagagctgggaacagcgccgagggccactgggtgcccgctcaggccttcctt
cctagcgcagaggcggaactgatctttttagaggaatcaccagattactgtacctgcaat
tccagcctgggcatctatggcacagagggtcgtgagtgcctacagaacagccacaacaca
tccaggtgggagcgacgtagctgtgggcgcctgtgcactgagtgtgggctgcaggtggaa
gagaggaaaactgaggtcataagcagctgtaactgcaaattccagtggtgctgtacggtc
aagtgtgaccagtgtaggcatgtgaccatgtccaacccagctgtgctgctgggaatcagg
agaatagaagcaaaaaatgaaagagttctgttcagacttctgaagatcagcctgtggcta
caaatctatgcagataaatga

KEGG   Pongo abelii (Sumatran orangutan): 100450268
Entry
100450268         CDS       T01416                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100450268 (WNT8B)
   04390 Hippo signaling pathway
    100450268 (WNT8B)
   04150 mTOR signaling pathway
    100450268 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100450268 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100450268 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450268 (WNT8B)
   05205 Proteoglycans in cancer
    100450268 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100450268 (WNT8B)
   05226 Gastric cancer
    100450268 (WNT8B)
   05217 Basal cell carcinoma
    100450268 (WNT8B)
   05224 Breast cancer
    100450268 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100450268 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    100450268 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100450268 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100450268 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100450268 (WNT8B)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100450268 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100450268
NCBI-ProteinID: XP_002821114
Ensembl: ENSPPYG00000002568
UniProt: H2NBB0 A0A663DIR1
LinkDB
Position
10
AA seq 351 aa
MFLSKPSVYISLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAW
DRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG
QLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTC
KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRS
ISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEE
RRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtttctttcaaagccttctgtgtacatctctcttttcacctgtgtcctccaactcagc
cacagctggtcagtgaacaatttcctgatgactggtccaaaggcttacctgatttactct
agcagtgtggcagctggtgcccagagtggtattgaagaatgcaagtatcagtttgcctgg
gaccgctggaactgccctgagagagccctgcagctgtccagccatggtgggcttcgcagt
gccaatcgggagacagcatttgtgcacgccatcagttctgctggagtcatgtacaccctg
actagaaactgcagccttggagattttgataactgtggctgtgatgactcccgcaatggg
caactggggggccaaggctggctgtggggaggctgcagtgacaatgtgggcttcggagag
gcgatttccaagcagtttgtcgatgccctggaaacaggacaggatgcacgggcagccatg
aacctgcacaataacgaggctggccgcaaggcggtgaagggcaccatgaaacgcacgtgc
aagtgccacggcgtgtctggcagctgcaccacgcagacctgttggctgcagctgcccgag
ttccgcgaggtgggcgcgcacctgaaggagaagtaccacgcagcactcaaggtggacctg
ctgcagggtgctggcaacagcgcggccggccgcggcgccatcgccgacacctttcgctcc
atctctacccgggagctggtgcacctggaggactccccggactactgcctggagaacaaa
acgctagggctgctgggcaccgaaggccgagagtgcctaaggcgcgggcgggccctgggt
cgctgggaacgccgcagctgccgccggctctgcggggactgcgggctggcggtggaggag
cgccgggccgagacggtgtccagctgcaactgcaagttccactggtgctgcgcagtccgc
tgcgagcagtgccgcaggagggtcaccaagtacttctgtagccgcgcagagcggccgcgg
gggggcgctgcgcacaaacccgggagaaaaccctaa

KEGG   Pongo abelii (Sumatran orangutan): 100451196
Entry
100451196         CDS       T01416                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100451196 (WNT7B)
   04390 Hippo signaling pathway
    100451196 (WNT7B)
   04150 mTOR signaling pathway
    100451196 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100451196 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100451196 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100451196 (WNT7B)
   05205 Proteoglycans in cancer
    100451196 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100451196 (WNT7B)
   05226 Gastric cancer
    100451196 (WNT7B)
   05217 Basal cell carcinoma
    100451196 (WNT7B)
   05224 Breast cancer
    100451196 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100451196 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    100451196 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100451196 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100451196 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100451196 (WNT7B)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100451196 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100451196
NCBI-ProteinID: XP_024095883
LinkDB
Position
22
AA seq 353 aa
MLLLSPRSALVSVYCPQIFLLLSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRP
DAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVA
HAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNA
RRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAV
QVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNR
TSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctcctactgtcgccgcgcagcgcgctcgtctccgtctattgcccgcagatctttctc
ctcctgtccagcggcagctacctagcactgtcatccgtggtggccctgggagccaacatc
atctgcaacaagattcctggcctagccccgcggcagcgtgccatctgtcagagccggccc
gatgccatcattgtgatcggggagggggcgcagatgggcatcaacgagtgccagtaccag
ttccgctttggacgctggaactgctctgccctcggcgagaagaccgtcttcgggcaagag
ctccgagtagggagccgtgaggctgccttcacgtatgccatcaccgcggccggcgtagcg
cacgccgtcaccgctgcctgcagccaaggcaacctgagcaactgtggctgtgaccgcgag
aagcagggttactacaaccaagctgagggctggaagtggggcggctgctcggctgacgtg
cgttacggcatcgacttctcccggcgcttcgtggacgctcgggagatcaagaagaacgcg
cggcgcctcatgaacctgcataacaatgaggccggcaggaaggttctagaggaccggatg
cagctggagtgcaagtgccacggcgtgtctggctcctgcaccaccaagacctgctggacc
acgctgcccaagttccgagaggtgggccacctgctgaaggagaagtacaacgcggccgtg
caggtggaggtggtacgggccagccgtctgcggcagcccaccttcctgcgcatcaaacag
ctgcgcagctatcagaagcccatggagacagacctggtgtacattgagaagtcgcccaac
tactgcgaggaggacgcggccacgggcagcgtgggcacgcagggccgtctctgcaaccgc
acgtcgcccggtgcggacggctgtgacaccatgtgctgcggccgaggctacaacacccac
cagtacaccaaggtgtggcagtgcaactgcaaattccactggtgctgcttcgtcaagtgc
aacacctgcagcgagcgcaccgaggtcttcacctgcaagtga

KEGG   Pongo abelii (Sumatran orangutan): 100452135
Entry
100452135         CDS       T01416                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100452135 (WNT9A)
   04390 Hippo signaling pathway
    100452135 (WNT9A)
   04150 mTOR signaling pathway
    100452135 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100452135 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100452135 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452135 (WNT9A)
   05205 Proteoglycans in cancer
    100452135 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100452135 (WNT9A)
   05226 Gastric cancer
    100452135 (WNT9A)
   05217 Basal cell carcinoma
    100452135 (WNT9A)
   05224 Breast cancer
    100452135 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100452135 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    100452135 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100452135 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100452135 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100452135 (WNT9A)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100452135 (WNT9A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100452135
NCBI-ProteinID: XP_009235120
Ensembl: ENSPPYG00000000151
LinkDB
Position
1
AA seq 365 aa
MLDGSPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTVLPLTLEPEAATQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KHLKHKYETALKVGSTTNEAAGEAGAISPPRGRVSGAGGSDPLPRTPELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctggatgggtccccgctggcgcgctggctggccgcggccttcgggctgacgctgctg
ctcgccgcgctgcgcccttcggccgcctacttcgggctgacgggcagcgagcccctgacc
gtcctcccgctgaccctggagccagaggcggccacccaggcgcactacaaggcctgcgac
cggctgaagctggagcggaagcagcggcgcatgtgccgccgggacccgggtgtggcagag
acgctggtggaggccgtgagcatgagtgcgctcgagtgccagttccagttccgctttgag
cgctggaactgcacgctggagggccgctaccgggccagcctgctcaagcgaggcttcaag
gagactgccttcctctatgccatctcctcggctggcctgacgcacgcactggccaaggcg
tgcagcgcgggccgcatggagcgctgtacctgtgatgaggcacccgacctggagaaccgt
gaggcttggcagtgggggggctgcggagacaacctcaagtacagcagcaagttcgtcaag
gaattcctgggcagacggtcaagcaaggatctgcgagcccgtgtggacttccacaacaac
ctcgtgggtgtgaaggtgatcaaggctggggtggagaccacctgcaagtgccacggcgtg
tcaggctcatgcaccgtgcggacctgctggcggcagttggcgcctttccatgaggtgggc
aagcatctgaagcacaagtatgagacggcactcaaggtgggcagcaccaccaatgaagct
gccggcgaggcaggtgccatctccccaccacggggccgggtctcgggggcaggcggcagc
gacccgctgccccgcactccagagctggtgcacctggatgactcacctagcttctgcctg
gctggccgcttctccccgggcaccgctggccgtaggtgccaccgcgagaagaactgcgag
agcatctgctgcggccgcggccataacacacagagccgggtggtgacgaggccctgccag
tgccaggtgcgttggtgctgctatgtggagtgcaggcagtgcacgcagcgtgaggaggtc
tacacctgcaagggctga

KEGG   Pongo abelii (Sumatran orangutan): 100452466
Entry
100452466         CDS       T01416                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100452466 (WNT16)
   04390 Hippo signaling pathway
    100452466 (WNT16)
   04150 mTOR signaling pathway
    100452466 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100452466 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100452466 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452466 (WNT16)
   05202 Transcriptional misregulation in cancer
    100452466 (WNT16)
   05205 Proteoglycans in cancer
    100452466 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100452466 (WNT16)
   05226 Gastric cancer
    100452466 (WNT16)
   05217 Basal cell carcinoma
    100452466 (WNT16)
   05224 Breast cancer
    100452466 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100452466 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    100452466 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100452466 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100452466 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100452466 (WNT16)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100452466 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100452466
NCBI-ProteinID: XP_002818419
Ensembl: ENSPPYG00000017947
UniProt: A0A663D5Y4 H2PNB7
LinkDB
Position
7
AA seq 365 aa
MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
KRKPYLLPSIREGARLGIQECRNQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKET
AFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSR
KFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMS
SFEKIGHLLKDKYENSIQISDKIKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKL
GIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTD
VHTCK
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggacagggcggcgctcctgggactggcccgcttgtgcgcgctgtgggcagccctgctc
gtgctgttcccctacggagcccaaggaaactggatgtggttgggcattgcctccttcggg
gttccagagaagctgggctgcgccaatttgccgctgaacagccgccagaaggagctgtgc
aagaggaaaccgtacctgctgccgagcatccgggagggcgcccggctgggcattcaggag
tgcaggaaccagttcagacacgagagatggaactgcatgatcaccgccgccgccaccacc
gccccgatgggcgccagccccctctttggctacgagctgagcagcggcaccaaagagaca
gcatttatttatgctgtgatggctgcaggcctggtgcattctgtgaccaggtcatgcagt
gcaggcaacatgacagagtgttcctgtgacaccaccttgcagaacggcggctcagcaagt
gaaggctggcactgggggggctgctctgatgatgtccagtatggcatgtggttcagcaga
aagttcctagatttccccattggaaacaccacgggcaaagaaaacaaagtactattagca
atgaacctacataacaatgaagctggaaggcaggctgtcgccaagttgatgtcagtagac
tgccgctgccacggagtttccggctcctgtgctgtgaaaacgtgctggaaaaccatgtct
tcttttgaaaagattggccatttgttgaaggataaatatgaaaacagtatccagatatca
gacaaaataaagaggaaaatgcgcaggagagaaaaagatcagaggaaaataccaatccac
aaggatgatctgctctatgttaataagtctcccaactactgtgtagaagataagaaactg
ggaatcccagggacacaaggcagagagtgcaaccgtacatcagagggtgcagatggctgc
aacctcctctgctgtggccgaggttacaacacccacgtggtcaggcacgtggagaggtgt
gagtgtaagttcatctggtgctgctatgtccgttgcaggaggtgtgaaagcatgactgat
gtccacacttgcaagtaa

KEGG   Pongo abelii (Sumatran orangutan): 100460815
Entry
100460815         CDS       T01416                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b isoform X1
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100460815 (WNT2B)
   04390 Hippo signaling pathway
    100460815 (WNT2B)
   04150 mTOR signaling pathway
    100460815 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100460815 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100460815 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460815 (WNT2B)
   05205 Proteoglycans in cancer
    100460815 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100460815 (WNT2B)
   05226 Gastric cancer
    100460815 (WNT2B)
   05217 Basal cell carcinoma
    100460815 (WNT2B)
   05224 Breast cancer
    100460815 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100460815 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100460815 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100460815 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100460815 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100460815 (WNT2B)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100460815 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100460815
NCBI-ProteinID: XP_002810473
Ensembl: ENSPPYG00000001023
UniProt: A0A6D2WMA1 H2N6D1
LinkDB
Position
1
AA seq 391 aa
MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSW
WYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTT
LDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQR
GDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCH
GVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV
YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFH
WCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgctgagaccgggtggtgcggaggaagctgcgcagctcccgcttcggcgcgccagcgcc
ccggtcccagtgccgtcgcccgcggcccccgacggctcccgggcttcggcccgcctaggt
cttgcctgccttctgctcctgctgctgctgacgctgccggcccgcgtagacacgtcctgg
tggtacattggggcactgggggcacgagtgatctgtgacaatatccctggtttggtgagc
cggcagcggcagctgtgccagcgttacccagatatcatgcgttcagtgggcgagggtgcc
cgagaatggatccgagagtgtcagcaccaattccgccaccaccgctggaactgtaccacc
ctggaccgggaccacaccgtctttggccgtgtcatgctcagaagtagccgagaggcagct
tttgtatatgccatctcatcagcaggggtagtccacgctattactcgtgcctgtagccag
ggtgaactgagtgtgtgcagctgtgacccctacacccgtggccgacaccatgaccagcgt
ggggactttgactggggtggctgcagtgacaacatccactatggtgtccgttttgccaag
gccttcgtggatgccaaggagaagaggcttaaggatgcccgggccctcatgaacttacat
aataaccgctgtggtcgcacggctgtgcggcggtttctgaagctggagtgtaagtgccat
ggcgtgagtggttcctgtactctgcgcacctgctggcgtgcactctcagatttccgccgc
acaggtgattacctgcggcggcgctatgatggggctgtgcaggtgatggccacccaggat
ggtgccaacttcaccgcagcccgccaaggctatcgccgtgccacccggactgatcttgtc
tactttgacaactctccagattactgtgtcttggacaaggctgcaggttccctaggcact
gcaggccgtgtctgcagcaagacatcaaaaggaacagacggttgtgaaatcatgtgctgt
ggccgagggtacgacacaactcgagtcacccgtgttacccagtgtgagtgcaaattccac
tggtgctgtgctgtacggtgcaaggaatgcagaaatactgtggatgtccatacttgcaag
gctcccaagaaggcagagtggctggaccagacctga

KEGG   Pongo abelii (Sumatran orangutan): 100462535
Entry
100462535         CDS       T01416                                 

Gene name
WNT9B
Definition
(RefSeq) protein Wnt-9b isoform X1
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100462535 (WNT9B)
   04390 Hippo signaling pathway
    100462535 (WNT9B)
   04150 mTOR signaling pathway
    100462535 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100462535 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100462535 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462535 (WNT9B)
   05205 Proteoglycans in cancer
    100462535 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100462535 (WNT9B)
   05226 Gastric cancer
    100462535 (WNT9B)
   05217 Basal cell carcinoma
    100462535 (WNT9B)
   05224 Breast cancer
    100462535 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100462535 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    100462535 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100462535 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100462535 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100462535 (WNT9B)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Morphogens
   100462535 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100462535
NCBI-ProteinID: XP_024091089
Ensembl: ENSPPYG00000008291
LinkDB
Position
17
AA seq 359 aa
MRPPPVLALAGLCLLALPAAAAAASYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLL
KLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNCSLEGRTGLLKRGFKETAF
LYAVSSAALTHTLARACSAGRMERCTCDDSLGLESRQAWQWGVCGDNLKYSTKFLSNFLG
SKRGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVL
KLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGDLVYMEDSPSFCRPSKYSP
GTAGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcgccccccgcccgtgctggccctggccgggctctgcctgctggcgctgcccgccgcc
gccgccgccgcctcctacttcggcctgaccgggcgggaagtcctgacgcccttcccagga
ttgggcactgcggcggccccggcacagggcggggcccacctgaagcagtgtgacctgctg
aagctgtcccggcggcagaagcagctctgccggagggagcccggcctggctgagaccctg
agggacgctgcacacctcggcctgcttgagtgccagtttcagttccggcatgagcgctgg
aactgtagcctggagggcaggacaggcctgctcaagagaggctttaaagagacagctttc
ctgtacgcggtgtcctctgccgccctcacccacaccctggcccgggcctgcagcgctggg
cgcatggagcgctgcacctgtgatgactctctggggctggagagccggcaggcctggcag
tggggcgtgtgcggtgacaacctcaagtacagcaccaagtttctgagcaacttcctgggg
tccaagagaggaaacaaggacctgcgggcacgggcagacgcccacaacacccacgtgggc
atcaaggctgtgaagagtggcctcaggaccacgtgtaagtgccatggcgtatcaggctcc
tgtgccgtgcgcacctgctggaagcagctctccccgttccgtgagacaggccaggtgctg
aaactgcgctatgactcggctgtcaaggtgtccagcgccaccaatgaggccttgggccgc
ctagagctgtgggcccctgccaggcagggcagcctcaccaaaggcctggccccgaggtct
ggggacctggtctacatggaggactcacccagcttctgccggcccagcaagtactcgcct
ggcacggcaggtagggtgtgctcccgggaggccagctgcagcagcctgtgctgcgggcgg
ggctatgacacccagagccgcctggtggccttctcctgccactgccaggtgcagtggtgc
tgctacgtggagtgccagcaatgtgtgcaggaggagcttgtgtacacctgcaagcactag

DBGET integrated database retrieval system