KEGG   Pongo abelii (Sumatran orangutan): 100137177
Entry
100137177         CDS       T01416                                 

Gene name
YWHAB
Definition
(RefSeq) 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04390  Hippo signaling pathway
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100137177 (YWHAB)
   04151 PI3K-Akt signaling pathway
    100137177 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100137177 (YWHAB)
   04114 Oocyte meiosis
    100137177 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100137177 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100137177 (YWHAB)
   05160 Hepatitis C
    100137177 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pon03400]
    100137177 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100137177 (YWHAB)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100137177 (YWHAB)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100137177 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 FliM SF3A2 Peptidase_C98
Other DBs
NCBI-GeneID: 100137177
NCBI-ProteinID: NP_001162074
Ensembl: ENSPPYG00000011041
UniProt: A4K2U9 A0A2J8XVX2
LinkDB
Position
20
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgacaatggataaaagtgagctggtacagaaagccaaactcgctgagcaggctgagcgc
tatgatgatatggctgcagccatgaaggcagtcacagaacaggggcatgaactctccaat
gaagagagaaatctgctctctgttgcctacaagaatgtggtaggcgcccgccgctcttcc
tggcgtgtcatctccagcattgagcagaaaacagagaggaacgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatagaggcagaactgcaggacatctgcaatgacgttctg
gagctgttggacaaatatcttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggagattattttaggtatctttctgaagtggcatctggagacaacaaa
caaaccactgtgtcgaactcccagcaggcttaccaggaagcatttgaaattagtaagaaa
gaaatgcaacctacacacccaattcgacttggtctggcacttaatttctcagtcttttac
tatgagattctaaactctcctgaaaaggcctgtagcctggcaaaaacggcatttgatgaa
gcaattgctgaattggatacactgaatgaagagtcttataaagacagcactctgatcatg
cagttacttagggacaatctcactctgtggacatcggaaaaccagggagacgaaggagac
gctggggagggagagaactaa

KEGG   Pongo abelii (Sumatran orangutan): 100171925
Entry
100171925         CDS       T01416                                 

Gene name
YWHAQ
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04390  Hippo signaling pathway
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100171925 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    100171925 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100171925 (YWHAQ)
   04114 Oocyte meiosis
    100171925 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100171925 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100171925 (YWHAQ)
   05160 Hepatitis C
    100171925 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pon03400]
    100171925 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100171925 (YWHAQ)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100171925 (YWHAQ)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100171925 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 100171925
NCBI-ProteinID: NP_001125044
Ensembl: ENSPPYG00000012663
UniProt: Q5RFJ2
LinkDB
Position
2A
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYPK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagactgagctgatccagaaggccaagctggccgagcaggccgagcgctacgat
gacatggccacctgcatgaaggcagtgaccgagcagggcgccgagctgtccaacgaggag
cgcaacctgctctccgtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctctagcatcgagcagaagaccgacacctccgacaagaagttgcagctgattaag
gactatcgggagaaagtggagtccgagctgagatccatctgcaccacggtcctggaattg
ttggataaatatttaatagccaatgcaactaatccagagagtaaggtcttctatccgaaa
atgaagggtgattacttccggtaccttgctgaagttgcatgtggtgatgatcgaaaacaa
acgatagataattcccaaggagcttaccaagaggcgtttgatataagcaagaaagagatg
caacccacacacccaatccgcctggggcttgctcttaacttttctgtattttactatgag
attcttaataacccagagcttgcctgcacgctggctaaaacggcttttgatgaggccatt
gctgaacttgatacactgaatgaagactcatacaaagacagcaccctcatcatgcagttg
cttagagacaacctaacactttggacatcagacagtgcaggagaagaatgtgatgcggca
gaaggggctgaaaactaa

KEGG   Pongo abelii (Sumatran orangutan): 100173609
Entry
100173609         CDS       T01416                                 

Gene name
YWHAZ
Definition
(RefSeq) 14-3-3 protein zeta/delta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04390  Hippo signaling pathway
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100173609 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    100173609 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100173609 (YWHAZ)
   04114 Oocyte meiosis
    100173609 (YWHAZ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100173609 (YWHAZ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100173609 (YWHAZ)
   05160 Hepatitis C
    100173609 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pon03400]
    100173609 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100173609 (YWHAZ)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100173609 (YWHAZ)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100173609 (YWHAZ)
SSDB
Motif
Pfam: 14-3-3 CSN7a_helixI FliM Peptidase_C98
Other DBs
NCBI-GeneID: 100173609
NCBI-ProteinID: NP_001126612
Ensembl: ENSPPYG00000018791
UniProt: Q5R651 A0A2J8UFH0
LinkDB
Position
8
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaatgagctggttcagaaggccaaactggccgagcaggctgagcgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctcaagtattgaacaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagacggagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagattactaccgttacttggctgaggttgccgctggtgatgacaagaaaggg
attgtggatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
caaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattatgag
attctgaactccccagagaaagcttgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaatta
ctgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcagga
gaaggaggggaaaattaa

KEGG   Pongo abelii (Sumatran orangutan): 100174383
Entry
100174383         CDS       T01416                                 

Gene name
YWHAG
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04390  Hippo signaling pathway
pon05160  Hepatitis C
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100174383 (YWHAG)
   04151 PI3K-Akt signaling pathway
    100174383 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100174383 (YWHAG)
   04114 Oocyte meiosis
    100174383 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100174383 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100174383 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100174383 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pon03400]
    100174383 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100174383 (YWHAG)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100174383 (YWHAG)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100174383 (YWHAG)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100174383 (YWHAG)
SSDB
Motif
Pfam: 14-3-3 DUF722 DUF3504 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Other DBs
NCBI-GeneID: 100174383
NCBI-ProteinID: NP_001127322
Ensembl: ENSPPYG00000017468
UniProt: Q5RC20 A0A2J8XU01
LinkDB
Position
7
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacagagctgaatgagccactgtcgaatgag
gaacgaaaccttctgtctgtggcctacaagaacgttgtgggggcacgccgctcttcctgg
agggtcatcagtagcattgagcagaagacatctgcagacggcaatgagaagaagattgag
atggtccgtgcgtaccgggagaagatagagaaggagttggaggctgtgtgccaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagcgagacccagtacgagagcaaa
gtgttctacctgaagatgaaaggggactactaccgctacctggctgaagtggccaccgga
gagaaaagggcgacggtggtggagtcctctgagaaggcctacagcgaagcccacgagatc
agcaaagagcacatgcagcccacccaccccatccgattaggcctggctcttaactactcc
gtcttctactatgagatccagaacgccccagagcaagcgtgccacttggccaagaccgcg
ttcgacgacgccatcgccgagcttgacaccctcaacgaggactcctacaaggactccacg
ctcatcatgcagctcctccgcgacaacctcacgctctggacgagcgaccagcaggacgac
gatggcggcgaaggcaacaattaa

KEGG   Pongo abelii (Sumatran orangutan): 100434385
Entry
100434385         CDS       T01416                                 

Gene name
YWHAH
Definition
(RefSeq) 14-3-3 protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04390  Hippo signaling pathway
pon05160  Hepatitis C
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100434385 (YWHAH)
   04151 PI3K-Akt signaling pathway
    100434385 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100434385 (YWHAH)
   04114 Oocyte meiosis
    100434385 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100434385 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100434385 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100434385 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pon03400]
    100434385 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100434385 (YWHAH)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100434385 (YWHAH)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100434385 (YWHAH)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100434385 (YWHAH)
SSDB
Motif
Pfam: 14-3-3 DUF722 CodY
Other DBs
NCBI-GeneID: 100434385
NCBI-ProteinID: XP_002831082
Ensembl: ENSPPYG00000011743
UniProt: H2P453 A0A663DEH6
LinkDB
Position
22
AA seq 246 aa
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgggggaccgggagcagttgctgcagcgggcgcggctggccgagcaggcggagcgctac
gacgacatggcctccgccatgaaggcggtgacagagctgaatgaacctctctccaatgaa
gatcgaaatctcctctctgtggcctacaagaatgtggttggtgccaggcgatcttcctgg
agggtcatcagcagcattgagcagaaaaccatggctgatggaaacgaaaagaaattggag
aaagttaaagcttaccgggagaagattgagaaggagctggagacagtttgcaatgatgtc
ctgtctctgcttgacaagttcctgatcaagaactgcaatgatttccagtatgagagcaag
gtgttttacctgaaaatgaaaggtgattactaccgctacttagcagaggtcgcttctggg
gagaagaaaaacagtgtggtcgaagcttctgaagctgcctacaaggaagcctttgaaatc
agcaaagagcagatgcaacccacgcatcccatccggctgggcctggccctcaacttctcc
gtattctactatgagatccagaatgcacccgagcaagcctgcctcttagccaaacaagcc
ttcgatgatgccatagctgagctggacacactaaacgaggattcctataaggactccacg
ctcatcatgcagttgctgcgagacaacctcaccctctggacgagcgaccagcaggatgaa
gaagcaggagaaggcaactga

KEGG   Pongo abelii (Sumatran orangutan): 100455220
Entry
100455220         CDS       T01416                                 

Gene name
YWHAE
Definition
(RefSeq) 14-3-3 protein epsilon isoform X1
  KO
K06630  14-3-3 protein epsilon
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04390  Hippo signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04722  Neurotrophin signaling pathway
pon05160  Hepatitis C
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100455220 (YWHAE)
   04151 PI3K-Akt signaling pathway
    100455220 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100455220 (YWHAE)
   04114 Oocyte meiosis
    100455220 (YWHAE)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100455220 (YWHAE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100455220 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100455220 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100455220 (YWHAE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pon03400]
    100455220 (YWHAE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100455220 (YWHAE)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100455220 (YWHAE)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100455220 (YWHAE)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 100455220
NCBI-ProteinID: XP_009249385
Ensembl: ENSPPYG00000007769
LinkDB
Position
17
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgagaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatac
gacgaaatggtggagtcaatgaagaaagtagcagggatggatgtggagctgacagttgaa
gaaagaaaccttctatctgttgcatataagaatgtgattggagctagaagagcctcctgg
agaataatcagcagcattgaacagaaagaagaaaacaagggaggagaagacaagctaaaa
atgattcgggaatatcggcaaatggttgagactgagctaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggcagaatttgccacaggaaacgac
aggaaggaggctgcggagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccaccaacgcatcctattcgcttaggtcttgctctcaatttttccgtattc
tactacgaaattcttaattcccctgaccgtgcctgcaggttggcaaaagcagctttcgat
gatgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacacttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgacggtgaa
gagcagaataaagaagcgctgcaggacgtggaagacgaaaatcagtga

KEGG   Pongo abelii (Sumatran orangutan): 112131710
Entry
112131710         CDS       T01416                                 

Definition
(RefSeq) 14-3-3 protein epsilon-like isoform X1
  KO
K06630  14-3-3 protein epsilon
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04390  Hippo signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04722  Neurotrophin signaling pathway
pon05160  Hepatitis C
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112131710
   04151 PI3K-Akt signaling pathway
    112131710
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112131710
   04114 Oocyte meiosis
    112131710
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112131710
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112131710
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112131710
  09172 Infectious disease: viral
   05160 Hepatitis C
    112131710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pon03400]
    112131710
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    112131710
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112131710
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   112131710
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-GeneID: 112131710
NCBI-ProteinID: XP_024097493
LinkDB
Position
Unknown
AA seq 171 aa
MVEPMKKLAGMDVELTAEERNFLSVTYENVIGATRASWRIMSSLEQKEGNKGGEDKRKMI
GKYRQMVETELKLICGDVLDALDKHLIPAATTGKSKVFYYEMKGDYHRYLAEFATGNDRK
EAAENSLVAYKAASDIAVREISPVHPIHLCLALHFSIFSCEILNFPDPACR
NT seq 516 nt   +upstreamnt  +downstreamnt
atggtggagccaatgaagaaattagcagggatggatgtagagctgacagctgaagagaga
aacttcctatctgttacatatgagaatgtgattggagctacaagagcctcctggagaata
atgagcagccttgaacagaaagaaggaaacaaaggaggagaagacaagcgaaaaatgatt
gggaaataccggcaaatggttgagactgagctaaagttaatctgtggcgacgttctggat
gcactggacaaacacctcattccagcagctaccactggcaagtccaaggttttctattat
gaaatgaaaggggactaccacaggtatctggcagaatttgccacaggaaatgacaggaag
gaggcagcagagaacagcctggtggcttacaaagctgctagtgatattgcagtaagagaa
atttcaccagtgcatcccattcacttatgtcttgctctccatttttccatattctcctgt
gaaattctgaatttccctgaccctgcctgcaggtaa

DBGET integrated database retrieval system