KEGG   Pongo abelii (Sumatran orangutan): 100171479
Entry
100171479         CDS       T01416                                 

Gene name
CYCS
Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100171479 (CYCS)
   04215 Apoptosis - multiple species
    100171479 (CYCS)
   04115 p53 signaling pathway
    100171479 (CYCS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100171479 (CYCS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100171479 (CYCS)
   05222 Small cell lung cancer
    100171479 (CYCS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100171479 (CYCS)
   05012 Parkinson disease
    100171479 (CYCS)
   05014 Amyotrophic lateral sclerosis
    100171479 (CYCS)
   05016 Huntington disease
    100171479 (CYCS)
   05017 Spinocerebellar ataxia
    100171479 (CYCS)
   05020 Prion disease
    100171479 (CYCS)
   05022 Pathways of neurodegeneration - multiple diseases
    100171479 (CYCS)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100171479 (CYCS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100171479 (CYCS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100171479 (CYCS)
   05134 Legionellosis
    100171479 (CYCS)
   05152 Tuberculosis
    100171479 (CYCS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100171479 (CYCS)
   05161 Hepatitis B
    100171479 (CYCS)
   05160 Hepatitis C
    100171479 (CYCS)
   05164 Influenza A
    100171479 (CYCS)
   05162 Measles
    100171479 (CYCS)
   05168 Herpes simplex virus 1 infection
    100171479 (CYCS)
   05163 Human cytomegalovirus infection
    100171479 (CYCS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100171479 (CYCS)
   05169 Epstein-Barr virus infection
    100171479 (CYCS)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100171479 (CYCS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100171479 (CYCS)
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 100171479
NCBI-ProteinID: NP_001124639
Ensembl: ENSPPYG00000017719
UniProt: Q5RFH4 A0A2J8VDX6
LinkDB
Position
7
AA seq 105 aa
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcgcagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatactcttacacagccgccaataaaaacaaaggcatcatctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttaatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Pongo abelii (Sumatran orangutan): 100445149
Entry
100445149         CDS       T01416                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100445149
   04215 Apoptosis - multiple species
    100445149
   04115 p53 signaling pathway
    100445149
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100445149
  09162 Cancer: specific types
   05210 Colorectal cancer
    100445149
   05222 Small cell lung cancer
    100445149
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100445149
   05012 Parkinson disease
    100445149
   05014 Amyotrophic lateral sclerosis
    100445149
   05016 Huntington disease
    100445149
   05017 Spinocerebellar ataxia
    100445149
   05020 Prion disease
    100445149
   05022 Pathways of neurodegeneration - multiple diseases
    100445149
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100445149
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100445149
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100445149
   05134 Legionellosis
    100445149
   05152 Tuberculosis
    100445149
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100445149
   05161 Hepatitis B
    100445149
   05160 Hepatitis C
    100445149
   05164 Influenza A
    100445149
   05162 Measles
    100445149
   05168 Herpes simplex virus 1 infection
    100445149
   05163 Human cytomegalovirus infection
    100445149
   05167 Kaposi sarcoma-associated herpesvirus infection
    100445149
   05169 Epstein-Barr virus infection
    100445149
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100445149
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100445149
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 DUF3365
Other DBs
NCBI-GeneID: 100445149
NCBI-ProteinID: XP_009248843
LinkDB
Position
16
AA seq 101 aa
MGDVEKGKKIFVQKCAQCHTMEKGGKHKTGSNLFGWKTGQAVGFSYTDTSKNKDITWGED
TLMEYLENLKKYIPGTKMIFAGIKKAKREDLIAYLKKATNE
NT seq 306 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccacacc
atggaaaagggaggcaagcacaagacagggtctaatctcttcgggtggaagacaggtcag
gctgttggattctcttacacagacaccagtaagaacaaagacatcacctggggagaggat
acactgatggagtatttggagaatctcaagaagtacatccctggaacaaaaatgatcttt
gccggcattaagaaggcaaaaagggaagacttgatagcttatcttaaaaaagctactaat
gagtaa

KEGG   Pongo abelii (Sumatran orangutan): 100462404
Entry
100462404         CDS       T01416                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100462404
   04215 Apoptosis - multiple species
    100462404
   04115 p53 signaling pathway
    100462404
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462404
  09162 Cancer: specific types
   05210 Colorectal cancer
    100462404
   05222 Small cell lung cancer
    100462404
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100462404
   05012 Parkinson disease
    100462404
   05014 Amyotrophic lateral sclerosis
    100462404
   05016 Huntington disease
    100462404
   05017 Spinocerebellar ataxia
    100462404
   05020 Prion disease
    100462404
   05022 Pathways of neurodegeneration - multiple diseases
    100462404
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100462404
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100462404
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100462404
   05134 Legionellosis
    100462404
   05152 Tuberculosis
    100462404
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100462404
   05161 Hepatitis B
    100462404
   05160 Hepatitis C
    100462404
   05164 Influenza A
    100462404
   05162 Measles
    100462404
   05168 Herpes simplex virus 1 infection
    100462404
   05163 Human cytomegalovirus infection
    100462404
   05167 Kaposi sarcoma-associated herpesvirus infection
    100462404
   05169 Epstein-Barr virus infection
    100462404
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100462404
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100462404
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 DDE_Tnp_1
Other DBs
NCBI-GeneID: 100462404
NCBI-ProteinID: XP_009242962
LinkDB
Position
1
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFRQKTGQAVGFSYTDANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKAEKADLTAYFKKGTNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgtcacacc
gtggaaaagggaggcaagcacaagactgggcctaatctccatggtctcttcaggcagaag
acaggtcaggctgttggattctcttacacagatgccaataagaacaaaggcatcatctgg
ggagaggatacactgatggagtatttggaaaatcccaagaagtacatccctggaacaaaa
atgatctttgccggcattaaaaagaaggcagaaaaggccgacttgacagcttatttcaaa
aaaggtactaatgagtaa

KEGG   Pongo abelii (Sumatran orangutan): 112128551
Entry
112128551         CDS       T01416                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112128551
   04215 Apoptosis - multiple species
    112128551
   04115 p53 signaling pathway
    112128551
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112128551
  09162 Cancer: specific types
   05210 Colorectal cancer
    112128551
   05222 Small cell lung cancer
    112128551
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112128551
   05012 Parkinson disease
    112128551
   05014 Amyotrophic lateral sclerosis
    112128551
   05016 Huntington disease
    112128551
   05017 Spinocerebellar ataxia
    112128551
   05020 Prion disease
    112128551
   05022 Pathways of neurodegeneration - multiple diseases
    112128551
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112128551
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112128551
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112128551
   05134 Legionellosis
    112128551
   05152 Tuberculosis
    112128551
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112128551
   05161 Hepatitis B
    112128551
   05160 Hepatitis C
    112128551
   05164 Influenza A
    112128551
   05162 Measles
    112128551
   05168 Herpes simplex virus 1 infection
    112128551
   05163 Human cytomegalovirus infection
    112128551
   05167 Kaposi sarcoma-associated herpesvirus infection
    112128551
   05169 Epstein-Barr virus infection
    112128551
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112128551
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112128551
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 112128551
NCBI-ProteinID: XP_024086499
LinkDB
Position
13
AA seq 105 aa
MGDVEKGKKIFVQKCAQYHTVEQGGKHKTGPNLHGLFGWKTGQAIGLSYIETDKNKGITW
GEDTLMEYFENSRKYIPGTKMIFAGIKNNAERADLIAYLKKATSE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaaaatttttgttcagaagtgtgcccagtaccacacc
gtggaacagggaggcaagcacaagactgggcctaatctccatggtctcttcgggtggaag
acaggtcaggccattggattatcttacatagagaccgataagaacaaaggcatcacctgg
ggagaggatacactaatggagtattttgagaattccaggaagtacattcctggaacaaaa
atgatctttgctggcattaagaacaatgcagaaagggcagacttgatagcttatctcaaa
aaagctactagtgagtaa

KEGG   Pongo abelii (Sumatran orangutan): 112128607
Entry
112128607         CDS       T01416                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112128607
   04215 Apoptosis - multiple species
    112128607
   04115 p53 signaling pathway
    112128607
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112128607
  09162 Cancer: specific types
   05210 Colorectal cancer
    112128607
   05222 Small cell lung cancer
    112128607
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112128607
   05012 Parkinson disease
    112128607
   05014 Amyotrophic lateral sclerosis
    112128607
   05016 Huntington disease
    112128607
   05017 Spinocerebellar ataxia
    112128607
   05020 Prion disease
    112128607
   05022 Pathways of neurodegeneration - multiple diseases
    112128607
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112128607
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112128607
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112128607
   05134 Legionellosis
    112128607
   05152 Tuberculosis
    112128607
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112128607
   05161 Hepatitis B
    112128607
   05160 Hepatitis C
    112128607
   05164 Influenza A
    112128607
   05162 Measles
    112128607
   05168 Herpes simplex virus 1 infection
    112128607
   05163 Human cytomegalovirus infection
    112128607
   05167 Kaposi sarcoma-associated herpesvirus infection
    112128607
   05169 Epstein-Barr virus infection
    112128607
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112128607
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112128607
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 112128607
NCBI-ProteinID: XP_024086876
LinkDB
Position
13
AA seq 106 aa
MGDVEKGKKIFVQKCARCHTMEMGGKHKTGPNLHGLFRWKTGQAIGLSYIDTDKNTGITW
GEDTLIEYFENPSNYIPGTKMIFAGIKKKAERADLIAYLRKATSEL
NT seq 321 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaaaatttttgttcagaagtgtgcccggtgccacacc
atggaaatgggaggcaagcacaagactgggcctaatctccatggtctcttccggtggaag
acaggtcaggccattggattatcttacatagacaccgataagaacacaggcatcacctgg
ggagaggatacactgatagagtattttgagaatcccagcaactacattcctggaacaaaa
atgatctttgccggcattaagaagaaggcagaaagggcagacttgatagcttatctcaga
aaagctactagtgagttataa

KEGG   Pongo abelii (Sumatran orangutan): 112130824
Entry
112130824         CDS       T01416                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112130824
   04215 Apoptosis - multiple species
    112130824
   04115 p53 signaling pathway
    112130824
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112130824
  09162 Cancer: specific types
   05210 Colorectal cancer
    112130824
   05222 Small cell lung cancer
    112130824
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112130824
   05012 Parkinson disease
    112130824
   05014 Amyotrophic lateral sclerosis
    112130824
   05016 Huntington disease
    112130824
   05017 Spinocerebellar ataxia
    112130824
   05020 Prion disease
    112130824
   05022 Pathways of neurodegeneration - multiple diseases
    112130824
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112130824
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112130824
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112130824
   05134 Legionellosis
    112130824
   05152 Tuberculosis
    112130824
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112130824
   05161 Hepatitis B
    112130824
   05160 Hepatitis C
    112130824
   05164 Influenza A
    112130824
   05162 Measles
    112130824
   05168 Herpes simplex virus 1 infection
    112130824
   05163 Human cytomegalovirus infection
    112130824
   05167 Kaposi sarcoma-associated herpesvirus infection
    112130824
   05169 Epstein-Barr virus infection
    112130824
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112130824
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112130824
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 112130824
NCBI-ProteinID: XP_024096519
LinkDB
Position
X
AA seq 105 aa
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGYSYTVANKNKGITW
GEDTLMEYLENPKKHIPETKMIFVGIKKKEERADLIAFLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggccgctggatactcttacacagtcgccaataagaacaaaggcatcacctgg
ggagaggatacgctgatggagtatttggagaatcccaagaagcacatccctgaaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttgatagcttttctcaaa
aaagctactaatgagtaa

KEGG   Pongo abelii (Sumatran orangutan): 112132396
Entry
112132396         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytochrome c 2-like
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112132396
   04215 Apoptosis - multiple species
    112132396
   04115 p53 signaling pathway
    112132396
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112132396
  09162 Cancer: specific types
   05210 Colorectal cancer
    112132396
   05222 Small cell lung cancer
    112132396
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112132396
   05012 Parkinson disease
    112132396
   05014 Amyotrophic lateral sclerosis
    112132396
   05016 Huntington disease
    112132396
   05017 Spinocerebellar ataxia
    112132396
   05020 Prion disease
    112132396
   05022 Pathways of neurodegeneration - multiple diseases
    112132396
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112132396
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112132396
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112132396
   05134 Legionellosis
    112132396
   05152 Tuberculosis
    112132396
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112132396
   05161 Hepatitis B
    112132396
   05160 Hepatitis C
    112132396
   05164 Influenza A
    112132396
   05162 Measles
    112132396
   05168 Herpes simplex virus 1 infection
    112132396
   05163 Human cytomegalovirus infection
    112132396
   05167 Kaposi sarcoma-associated herpesvirus infection
    112132396
   05169 Epstein-Barr virus infection
    112132396
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112132396
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112132396
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Other DBs
NCBI-GeneID: 112132396
NCBI-ProteinID: XP_024099703
LinkDB
Position
2B
AA seq 144 aa
MGDAEAGKKTFIPKCALCHTVEKGEKHKTGPNLWGLFGXKTGKAPGFSYTEANKNKGIVW
GKETLMEYLENPKKYIPRTKYIPGTKMIFSSLKKKSEREDLIQYLKWATSSLRKCKPKFL
ISKIARLEKSYLIFFDQPVVSLTF
NT seq 435 nt   +upstreamnt  +downstreamnt
atgggagatgctgaagcaggcaagaagaccttcattccaaaatgtgctctgtgccacaca
gtggaaaaaggtgaaaaacacaagactggtccaaatctctggggcctctttggctgaaaa
acaggaaaagcaccaggattttcttatacagaggcaaacaaaaacaagggtattgtatgg
ggaaaagagactctgatggaatatttggagaacccaaagaaatatatccctcggactaaa
tatatccctggaactaaaatgatcttttctagtcttaaaaagaagagtgagagagaagat
cttattcaatatttgaaatgggcaacatcttcacttcggaaatgtaagccaaaatttctg
atttcaaaaattgcacgtttagagaagtcatatttgatcttttttgatcagcctgtagta
agtttaacattttaa

KEGG   Pongo abelii (Sumatran orangutan): 112133797
Entry
112133797         CDS       T01416                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112133797
   04215 Apoptosis - multiple species
    112133797
   04115 p53 signaling pathway
    112133797
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112133797
  09162 Cancer: specific types
   05210 Colorectal cancer
    112133797
   05222 Small cell lung cancer
    112133797
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112133797
   05012 Parkinson disease
    112133797
   05014 Amyotrophic lateral sclerosis
    112133797
   05016 Huntington disease
    112133797
   05017 Spinocerebellar ataxia
    112133797
   05020 Prion disease
    112133797
   05022 Pathways of neurodegeneration - multiple diseases
    112133797
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112133797
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112133797
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112133797
   05134 Legionellosis
    112133797
   05152 Tuberculosis
    112133797
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112133797
   05161 Hepatitis B
    112133797
   05160 Hepatitis C
    112133797
   05164 Influenza A
    112133797
   05162 Measles
    112133797
   05168 Herpes simplex virus 1 infection
    112133797
   05163 Human cytomegalovirus infection
    112133797
   05167 Kaposi sarcoma-associated herpesvirus infection
    112133797
   05169 Epstein-Barr virus infection
    112133797
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112133797
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112133797
SSDB
Motif
Pfam: Cytochrom_C Cytochrom_C550
Other DBs
NCBI-GeneID: 112133797
NCBI-ProteinID: XP_024104353
LinkDB
Position
6
AA seq 109 aa
MGDVEKGKKIFIMKRSQCHIVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAINKNKYIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEEAGRERADLMAYLKKATNE
NT seq 330 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagcgttcccagtgccacatt
gttgaaaagggaggcaagcataagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatactcttacacagccatcaataagaacaaatacatcatctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgtcggcattaagaagaaggaagaggccgggcgcgaaagggcagacttgatg
gcttatctcaaaaaagctactaatgagtaa

KEGG   Pongo abelii (Sumatran orangutan): 112134371
Entry
112134371         CDS       T01416                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112134371
   04215 Apoptosis - multiple species
    112134371
   04115 p53 signaling pathway
    112134371
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112134371
  09162 Cancer: specific types
   05210 Colorectal cancer
    112134371
   05222 Small cell lung cancer
    112134371
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112134371
   05012 Parkinson disease
    112134371
   05014 Amyotrophic lateral sclerosis
    112134371
   05016 Huntington disease
    112134371
   05017 Spinocerebellar ataxia
    112134371
   05020 Prion disease
    112134371
   05022 Pathways of neurodegeneration - multiple diseases
    112134371
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112134371
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112134371
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112134371
   05134 Legionellosis
    112134371
   05152 Tuberculosis
    112134371
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112134371
   05161 Hepatitis B
    112134371
   05160 Hepatitis C
    112134371
   05164 Influenza A
    112134371
   05162 Measles
    112134371
   05168 Herpes simplex virus 1 infection
    112134371
   05163 Human cytomegalovirus infection
    112134371
   05167 Kaposi sarcoma-associated herpesvirus infection
    112134371
   05169 Epstein-Barr virus infection
    112134371
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112134371
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112134371
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 112134371
NCBI-ProteinID: XP_024105906
LinkDB
Position
7
AA seq 104 aa
MGDVEKSKNICVQKCAQCHTTEKGGKHKTEPNLHGLFGWKTGAIGFCYTDTSKNKDITWG
EDTLIEYLENPKNYIPGTKMIFGGIKKKGERADLRAYLKKAAHE
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaagcaagaatatttgtgttcagaagtgtgcccagtgccacacc
acggaaaagggaggcaagcacaagactgagcctaacctccatggtctctttgggtggaag
acaggtgccattggattctgctacacagacaccagtaagaacaaagacatcacctgggga
gaggacacactgatagagtatttggagaatccaaagaattacatacctggaacaaaaatg
atctttggcggcattaagaagaagggagaaagggcggacttgagagcttatctcaaaaaa
gctgctcatgagtaa

KEGG   Pongo abelii (Sumatran orangutan): 112134675
Entry
112134675         CDS       T01416                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112134675
   04215 Apoptosis - multiple species
    112134675
   04115 p53 signaling pathway
    112134675
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112134675
  09162 Cancer: specific types
   05210 Colorectal cancer
    112134675
   05222 Small cell lung cancer
    112134675
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112134675
   05012 Parkinson disease
    112134675
   05014 Amyotrophic lateral sclerosis
    112134675
   05016 Huntington disease
    112134675
   05017 Spinocerebellar ataxia
    112134675
   05020 Prion disease
    112134675
   05022 Pathways of neurodegeneration - multiple diseases
    112134675
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112134675
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112134675
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112134675
   05134 Legionellosis
    112134675
   05152 Tuberculosis
    112134675
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112134675
   05161 Hepatitis B
    112134675
   05160 Hepatitis C
    112134675
   05164 Influenza A
    112134675
   05162 Measles
    112134675
   05168 Herpes simplex virus 1 infection
    112134675
   05163 Human cytomegalovirus infection
    112134675
   05167 Kaposi sarcoma-associated herpesvirus infection
    112134675
   05169 Epstein-Barr virus infection
    112134675
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112134675
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112134675
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 112134675
NCBI-ProteinID: XP_024107106
LinkDB
Position
8
AA seq 117 aa
IGDVEKVKKIFVQKCVQCHIMEKGRKHKTGPNLHGLFGQKTGQAVGFSYTDANKNKGITW
GEDTLMVYLETPKKYILGTEMIFAFIKKVERADLIACLKKATTELANALFITKQNVP
NT seq 354 nt   +upstreamnt  +downstreamnt
atcggtgatgttgagaaagtcaagaagatctttgttcagaagtgtgtccagtgccacatc
atggaaaagggacgcaagcacaagactgggcctaatctccatggtctcttcgggcagaag
acaggtcaggctgttggattctcttacacagatgccaataagaacaaaggcatcacctgg
ggagaggatacactgatggtgtatttggagactcccaagaagtacatccttggaacagaa
atgatctttgccttcattaagaaggtagaaagggcagacttgatagcttgtctcaaaaaa
gctactactgagttggccaatgccttatttattacaaaacagaatgtcccatga

KEGG   Pongo abelii (Sumatran orangutan): 112134685
Entry
112134685         CDS       T01416                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112134685
   04215 Apoptosis - multiple species
    112134685
   04115 p53 signaling pathway
    112134685
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112134685
  09162 Cancer: specific types
   05210 Colorectal cancer
    112134685
   05222 Small cell lung cancer
    112134685
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112134685
   05012 Parkinson disease
    112134685
   05014 Amyotrophic lateral sclerosis
    112134685
   05016 Huntington disease
    112134685
   05017 Spinocerebellar ataxia
    112134685
   05020 Prion disease
    112134685
   05022 Pathways of neurodegeneration - multiple diseases
    112134685
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112134685
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112134685
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112134685
   05134 Legionellosis
    112134685
   05152 Tuberculosis
    112134685
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112134685
   05161 Hepatitis B
    112134685
   05160 Hepatitis C
    112134685
   05164 Influenza A
    112134685
   05162 Measles
    112134685
   05168 Herpes simplex virus 1 infection
    112134685
   05163 Human cytomegalovirus infection
    112134685
   05167 Kaposi sarcoma-associated herpesvirus infection
    112134685
   05169 Epstein-Barr virus infection
    112134685
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112134685
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112134685
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 112134685
NCBI-ProteinID: XP_024107167
LinkDB
Position
8
AA seq 104 aa
MGDVEKGKRFFVQNCAQFHTVEKGGKHMAESNLHGLFAGKTDQAIGFSYTEAHKNKSITW
GEDTLMEYLENPKKHIPGTKMIFADMKNKAERAALIAHLKKSYQ
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggggatgttgaaaaaggcaagagattttttgttcagaactgtgcccagttccacact
gttgaaaagggaggcaaacacatggctgagtcaaatctccatggtctctttgcggggaag
acagatcaggccattggattctcttatacagaggcccataagaacaaaagcatcacctgg
ggagaggatacactcatggagtatttggagaatcccaagaagcacatccccggaacaaaa
atgatcttcgcagacatgaagaacaaggcagaaagggcggccttgatagctcatctcaaa
aaaagctaccaatga

KEGG   Pongo abelii (Sumatran orangutan): 112134960
Entry
112134960         CDS       T01416                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112134960
   04215 Apoptosis - multiple species
    112134960
   04115 p53 signaling pathway
    112134960
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112134960
  09162 Cancer: specific types
   05210 Colorectal cancer
    112134960
   05222 Small cell lung cancer
    112134960
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112134960
   05012 Parkinson disease
    112134960
   05014 Amyotrophic lateral sclerosis
    112134960
   05016 Huntington disease
    112134960
   05017 Spinocerebellar ataxia
    112134960
   05020 Prion disease
    112134960
   05022 Pathways of neurodegeneration - multiple diseases
    112134960
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112134960
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112134960
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112134960
   05134 Legionellosis
    112134960
   05152 Tuberculosis
    112134960
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112134960
   05161 Hepatitis B
    112134960
   05160 Hepatitis C
    112134960
   05164 Influenza A
    112134960
   05162 Measles
    112134960
   05168 Herpes simplex virus 1 infection
    112134960
   05163 Human cytomegalovirus infection
    112134960
   05167 Kaposi sarcoma-associated herpesvirus infection
    112134960
   05169 Epstein-Barr virus infection
    112134960
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112134960
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112134960
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 112134960
NCBI-ProteinID: XP_024108411
LinkDB
Position
9
AA seq 111 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGHDLHGLFGQKTGQATGFSYTDTNKNKGITW
GEDTLMEYLENPKKYIPGTKTIFAGIKKKAERADLIAYLKKSYYFLIYKQE
NT seq 336 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccacacc
gtggaaaagggaggcaagcataagactgggcatgatctccatggtctcttcgggcagaag
acaggtcaggccactggattctcttacacagacaccaataaaaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
acgatctttgctggcattaagaagaaggcagaaagggcagacttgatagcttatctcaaa
aaaagctactatttcctcatctataaacaggaataa

KEGG   Pongo abelii (Sumatran orangutan): 112135506
Entry
112135506         CDS       T01416                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05222  Small cell lung cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112135506
   04215 Apoptosis - multiple species
    112135506
   04115 p53 signaling pathway
    112135506
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112135506
  09162 Cancer: specific types
   05210 Colorectal cancer
    112135506
   05222 Small cell lung cancer
    112135506
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112135506
   05012 Parkinson disease
    112135506
   05014 Amyotrophic lateral sclerosis
    112135506
   05016 Huntington disease
    112135506
   05017 Spinocerebellar ataxia
    112135506
   05020 Prion disease
    112135506
   05022 Pathways of neurodegeneration - multiple diseases
    112135506
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112135506
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112135506
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112135506
   05134 Legionellosis
    112135506
   05152 Tuberculosis
    112135506
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112135506
   05161 Hepatitis B
    112135506
   05160 Hepatitis C
    112135506
   05164 Influenza A
    112135506
   05162 Measles
    112135506
   05168 Herpes simplex virus 1 infection
    112135506
   05163 Human cytomegalovirus infection
    112135506
   05167 Kaposi sarcoma-associated herpesvirus infection
    112135506
   05169 Epstein-Barr virus infection
    112135506
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112135506
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112135506
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 112135506
NCBI-ProteinID: XP_024111540
LinkDB
Position
11
AA seq 105 aa
MGVVEKGKKIFVQKCAQCHTMEKGGQHKTGPNLHSLCRQETGEAVEYSYTDTNKNKGITW
GKDTLMHYLETPKKNIPGTKMIFAGIKKKAERADLIANLKNATHQ
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgttgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccacaca
atggaaaagggaggccagcacaagactgggcctaatctccatagtctctgcaggcaggag
acaggtgaggccgttgaatactcttacacagacaccaataagaacaaaggcatcacctgg
ggaaaggatacactgatgcactatttggagactcccaagaagaacatccctggaacaaaa
atgatctttgccggcattaagaagaaggcagaaagggcagacttgatagctaatctcaaa
aatgctactcatcagtaa

DBGET integrated database retrieval system