KEGG   Pongo abelii (Sumatran orangutan): 100171495
Entry
100171495         CDS       T01416                                 

Gene name
SLC44A4
Definition
(RefSeq) choline transporter-like protein 4
  KO
K15377  solute carrier family 44 (choline transporter-like protein), member 2/4/5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100171495 (SLC44A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100171495 (SLC44A4)
   04147 Exosome [BR:pon04147]
    100171495 (SLC44A4)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC44: Choline-like transporter
   100171495 (SLC44A4)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100171495 (SLC44A4)
SSDB
Motif
Pfam: Choline_transpo
Other DBs
NCBI-GeneID: 100171495
NCBI-ProteinID: NP_001124654
Ensembl: ENSPPYG00000016466
UniProt: Q5RFE7
LinkDB
Position
6
AA seq 582 aa
MGGKQRDEDDEAYGKPVKYDPSFRGPIKNRSCTDVICCVLFLLFILGYIVVGIVAWLYGD
PRQVLYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSTNIISVAENGLQCPTPQVCVSSC
PVDPWTVGKNQFLQTVGEVFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGR
CFPWTNVTPPALPGITNDTTIQQGISGLIDSLNAQDISVKIFEDFAQSWYWILVALGVAL
VLSLLFILLLRLVAGPLVLVLILGVLGVLAYGIYYCWEEYRVLRDKGASISQLGFTTNLS
AYQSVQETWLAALIVLVVLEAILLLVLIFLRQRIRIAIALLKEASKAVGQMMSTMFYPLV
TFVLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCEKVPINTSCNPTAQLVNSSCP
GLMCVFQGYSSKGLVQRSLFNLQIYGVLGLFWTLNWVLALGQCVLAGAFASFYWAFHKPQ
DIPTFPLISAFIRTLRYHTGSLAFGALILTLVQIARVILEYIDHKLRGVQNPVARCIMCC
FKCCLWCLEKFIKFLNRNAYIMIAIYGKNFCVSAKNAFMLLM
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggggggaaagcagcgggacgaggatgacgaggcctacgggaagccagtcaaatacgac
ccctcctttcgaggccccatcaagaacagaagctgcacagatgtcatctgctgcgtcctc
ttcctgctcttcattctaggttacatcgtggtggggattgtggcctggttgtatggagac
ccgcggcaagtcctctaccccaggaactctaccggggcctactgtggcatgggggagaac
aaagataagccgtatctcctgtacttcaacatcttcagctgcatcctgtccaccaacatc
atctcagtggctgagaacggcctacagtgccccacgccccaggtgtgtgtgtcctcctgc
ccggttgacccatggactgtgggaaaaaaccagttcttgcagactgttggggaagtcttc
tatacaaaaaacaggaacttttgtctgccaggggtaccctggaatatgacggtgatcaca
agcctgcaacaggaactctgccccagtttcctcctcccctctgctccagctctggggcgc
tgctttccatggaccaacgttactccaccggcgctcccagggatcaccaatgacaccacc
atacagcaagggatcagcggtcttattgacagcctcaatgcccaagacatcagtgttaag
atctttgaagattttgcccagtcctggtattggattcttgttgccctgggggtggctctg
gtcttgagcctactgtttatcttgcttctgcgcctggtggccgggcccctggtgctggtg
ctgatcctgggagtgctgggcgtgctggcatacggcatctactactgttgggaggagtac
cgagtgctgcgggacaagggcgcctccatctcccagctgggtttcaccaccaacctcagt
gcctaccagagcgtgcaggagacctggctggctgccctgatcgtgttggtggtgcttgaa
gccatcctgctgctggtgctcatcttcctgcggcagcggattcgtattgccatcgccctc
ctgaaggaggccagcaaggctgtgggacagatgatgtctaccatgttctacccactggtc
acctttgtcctcctcctcatctgcattgcctactgggccatgactgctctgtacctggct
acatcggggcaaccccagtatgtgctctgggcatccaacatcagctcccctggctgtgag
aaagtgccaataaatacatcatgcaaccccacggcccagcttgtgaactcctcgtgccca
gggctgatgtgcgtcttccagggctactcatccaaaggcctagtccaacgttctctcttc
aacctgcaaatctatggggtcctggggctcttctggacccttaactgggtactggccctg
ggccagtgcgtcctcgctggagcctttgcctccttctactgggccttccacaagccccag
gacatccctaccttccccttaatctctgccttcatccgcacactccgttaccacactggc
tcattggcatttggagccctcatcctgacccttgtgcagatagcccgggtcatcttggag
tatattgaccacaagctcagaggagtgcagaaccctgtagcccgctgcatcatgtgctgt
ttcaagtgctgcctctggtgtctggaaaaatttatcaagttcctaaaccgcaatgcatac
atcatgatcgccatctacgggaagaatttctgtgtctcagccaaaaatgccttcatgcta
ctcatgtga

KEGG   Pongo abelii (Sumatran orangutan): 100173738
Entry
100173738         CDS       T01416                                 

Gene name
SLC44A2
Definition
(RefSeq) choline transporter-like protein 2
  KO
K15377  solute carrier family 44 (choline transporter-like protein), member 2/4/5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100173738 (SLC44A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100173738 (SLC44A2)
   04147 Exosome [BR:pon04147]
    100173738 (SLC44A2)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC44: Choline-like transporter
   100173738 (SLC44A2)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100173738 (SLC44A2)
SSDB
Motif
Pfam: Choline_transpo
Other DBs
NCBI-GeneID: 100173738
NCBI-ProteinID: NP_001126736
UniProt: Q5R5L9
LinkDB
Position
19
AA seq 711 aa
MGDERPHYYGKHGTPQKYDPTFKGPIYNRGCTDVICCVFLLVAIVGYVAVGIIAWTHGDP
RKVIYPTDSRGEFCGQEGTKNENKPYLFYFNIVKCASPLVLLEFQCPTPQICVEKCPNRY
LTYLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLVRRCFPAIHAYK
GVLMVGNETTYEDGHGARKNITDLVEGAKKANGVLEARQLAMRIFEDYTVSWYWIIIGLV
IAMAMSLLFIILLRFLAGIMVWVMIIMVILVLGYGIFHCYMEYSRLRGEAGSDVSLVDLG
FQTDFRVYLHLRQTWLAFMIILSILEVIIILLLIFLRKRILIAIALIKEASRAVGYVMCT
MLYPLVTFFLLCLCIAYWASTAVFLSTSNEAVYKIFDDGLCPFTAKTCNPETFPSSNESR
QCPNARCQFAFYGGESGYHRALLGLQIFNAFMFFWLANFVLALGQVTLAGAFASYYWALR
KPDDLPAFPLFSAFGRALRYHTGSLAFGALILAIVQIIRVILEYLDQRLKAAENKFAKCL
MTCLKCCFWCLEKFIKFLNRNAYIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDF
LFLLGKLLIVGSVGILAFFFFTHRIRIVQDTAPPLNYYWVPILTVIVGSYLIAHGFFSVY
GMCVDTLFLCFCEDLERNDGSQERPYFMSPELRDILLKGSAEEGKRAEAEE
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgggggacgagcggccccactactacgggaaacacggaacgccacagaagtatgatccc
actttcaaaggacccatttacaacaggggctgcacggatgtcatatgctgtgtgttcctg
ctcgtggccattgtgggctacgtggctgtgggcatcatagcctggactcatggagaccct
cgaaaggtgatctaccccactgatagccgaggcgagttctgcgggcaggagggcacaaaa
aacgagaacaaaccctatctgttttatttcaacattgtgaaatgtgccagccccctggtt
ctgctggaattccaatgtcccactccccagatctgcgtggaaaaatgccccaaccgctac
ctcacgtacctgaatgctcgcagctcccgggactttgagtactataagcagttctgtgtt
cctggcttcaagaacaataaaggagtggctgaggtgcttcgagatggtgactgccctgct
gtcctcatccccagcaaacccttggtccggagatgcttccccgctatccacgcctacaag
ggtgtcctgatggtgggcaatgagacaacctatgaggatgggcatggcgcccggaaaaac
atcacagacctggtggagggcgctaagaaagccaatggagtcctagaggcacggcaactc
gccatgcgcatatttgaagattacaccgtctcttggtactggattatcataggcctggtc
attgccatggcgatgagcctcctgttcatcatcctgctccgcttcctggctggtattatg
gtctgggtgatgatcatcatggtgattctggtgctgggctacggaatatttcactgctac
atggagtactcccgactgcgtggtgaggccggctctgatgtgtctttggtggacctcggc
tttcagacggatttccgggtgtacctgcacttacggcagacctggttggcctttatgatc
attctgagtatccttgaagtcattatcatcttgctgctcatctttctccggaagagaatt
ctcatcgcgattgcactcatcaaagaagccagcagggctgtgggatacgtcatgtgcacc
atgctctacccactggtcactttcttcttgctgtgcctctgcatcgcctactgggccagc
actgctgtcttcctgtccacttccaacgaagcggtctataagatctttgatgacggcctc
tgcccatttactgcgaaaacctgcaacccagagaccttcccctcctccaatgagtcccgc
caatgccccaacgcccgttgccagttcgccttctacggtggtgagtcgggctaccaccgg
gccctactgggcctgcagatcttcaatgccttcatgttcttctggttggccaacttcgtg
ctggcgctgggccaggtcacgctggctggggcctttgcctcctattactgggctctgcgc
aagccggacgacctgccggccttcccgctcttctcagcctttggccgggcgctcaggtac
cacacaggctccctggcctttggcgcgctcatcttggccattgtgcagatcatccgcgtg
atactcgagtacctggatcagcggctgaaagccgcagagaacaagtttgccaagtgcctc
atgacctgtctcaaatgctgcttctggtgcctggagaagttcatcaaattcctcaatagg
aatgcctacatcatgattgccatctacggcaccaatttctgcacgtcggccaggaatgcc
ttcttcctgctcatgagaaacatcataagagtggctgtcctggataaagttactgacttc
ctcttcctgttgggcaaacttctgatcgttggtagtgtggggatcctggctttcttcttc
ttcacccaccgtatcaggatcgtgcaggatacagcgccacccctcaattattactgggtt
cctatactgacggtgatcgttggctcctacttgattgcacatggtttcttcagtgtctat
ggcatgtgtgtggacacgctgttcctctgcttctgtgaggacctggaaaggaatgacggc
tctcaggagcgaccctacttcatgtcgcccgagctgagagacatcctgttgaaggggagt
gcggaggaggggaagcgggcggaagccgaggagtag

KEGG   Pongo abelii (Sumatran orangutan): 100173770
Entry
100173770         CDS       T01416                                 

Gene name
SLC22A2
Definition
(RefSeq) solute carrier family 22 member 2
  KO
K08199  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100173770 (SLC22A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100173770 (SLC22A2)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   100173770 (SLC22A2)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    100173770 (SLC22A2)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 100173770
NCBI-ProteinID: NP_001126767
Ensembl: ENSPPYG00000017151
UniProt: Q5R5H7
LinkDB
Position
6
AA seq 555 aa
MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFTPIYVGIVFLGFTPDHRCRSPGVAELS
LRCGWSPAEELNYTVPGPGPAGEASPRQCGRYEVDWNQSAFGCVDPLASLDTNRSRLPLG
PCREGWVYETPGSSIVTEFNLVCANSWMLDLFQASVNVGFFFGSVSIGYIADRFGRKLCL
LTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIF
YQVAYTVGLLVLAGVAYALPHWRWLQFTVTLPNFFFLLYYWCIPESPRWLISQNKNAEAM
RIIKHIAKKNGKSLPASLQCLRLEEETGEKLNPSFLDLVRTPQIRKHTMILMYNWFTSSV
LYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIIVTIDRIGRRYPWAASNMVAGAACLA
SVFIPGDLQWLKIIISCLGRMGITMAYEIVRLVNAELYPTFIRNLGVHICSSMCDIGGII
TPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKE
KMIYLQVQKLDIPLN
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgcccaccaccgtggacgatgtcctggagcatggaggggagtttcattttttccagaag
caaatgtttttcctcttggctctgctctcggctaccttcacgcccatctacgtgggcatc
gtcttcctgggcttcacccctgaccaccgctgccggagccccggagtggctgagctgagt
ctgcgctgcggctggagtcctgcagaggaactgaactacacggtgcccggcccaggacct
gcgggcgaggcctccccaagacagtgtgggcgctacgaggtggactggaaccagagcgcc
tttggctgcgtggaccccctggccagcttggacaccaacaggagccgcctaccactgggc
ccctgccgggaaggctgggtgtacgagacgcctggctcctccatcgtcaccgagtttaac
ctggtatgtgccaactcctggatgttggacctattccaggcatcagtgaatgtaggattc
tttttcggctctgtgagtatcggctacatagcagacaggtttggccgtaagctctgcctc
ctaactacagtcctaataaatgctgcagctggagttctcatggccatttccccaacctat
acatggatgttaatttttcgcttaatccaaggactggtcagcaaagcaggctggttaata
ggctacatcctgattacagaatttgttgggcggagatatcggagaacagtggggattttt
taccaagttgcctatacagttgggctcctggtgctagctggggtggcttacgcacttcct
cactggaggtggttgcagttcacagttactctgcccaacttcttcttcttgctctattac
tggtgcatacctgagtctcccaggtggctgatctcccagaataagaatgctgaagccatg
agaataattaagcacatcgcaaagaaaaatggaaaatctctacccgcctcccttcagtgc
ctgagacttgaagaggaaactggcgagaaattgaacccttcatttcttgacttggtcaga
actcctcagatacggaaacatactatgatattgatgtacaactggttcacgagctctgtg
ctctaccagggcctcatcatgcacatgggccttgcaggggacaatatctacctggatttc
ttctactctgccctggttgaattcccagctgccttcatgatcatcgtcaccatcgaccgc
atcggccgccgttacccttgggctgcatcaaatatggttgcaggggcagcctgtctggcc
tcagtttttatccctggtgatctacaatggctaaaaattattatctcatgcttgggaaga
atggggatcacaatggcctatgagatagtgcgcctggtcaatgctgagctgtaccccaca
ttcattaggaatcttggcgtccacatctgttcctcaatgtgtgacattggtggcatcatc
acgccattcctggtctaccggctcactaacatctggcttgagctcccgctaatggttttt
ggcgtgcttggcttggttgctggaggtctggtgctgttgcttccagaaactaaagggaag
gctttgcctgagaccatcgaggaagccgaaaatatgcaaagaccaagaaaaaataaagaa
aagatgatttacctccaagttcagaaactagacattccattgaactaa

KEGG   Pongo abelii (Sumatran orangutan): 100436901
Entry
100436901         CDS       T01416                                 

Gene name
SLC22A1
Definition
(RefSeq) solute carrier family 22 member 1 isoform X1
  KO
K08198  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04976  Bile secretion
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100436901 (SLC22A1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100436901 (SLC22A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100436901 (SLC22A1)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   100436901 (SLC22A1)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    100436901 (SLC22A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 100436901
NCBI-ProteinID: XP_002817591
Ensembl: ENSPPYG00000017150
UniProt: A0A6D2X4Q5 H2PKS9
LinkDB
Position
6
AA seq 554 aa
MPTVDDILEQVGEFGWFQKQAFLILCLLSAAFAPICVGIVFLGFIPDHHCQSPGVAELSQ
RCGWSPAEELNYTVPGLGPAGEAFLAQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFFFGSLGVGYFADRFGRKLCLL
GTVLVNAVSGVLLAFAPNYVSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
IMDHIAQKNGKLPPADLKMLSLKEDVTEKLSPSFADLFRMPRLRKHTFILMYLWFTASVL
YQGLILHMGATSGNLYLDFLYSALVEFPGAFITLITIDRVGRIYPTAVSNLLAGAACLFM
IFISPDLHWLNLIIMCVGRMGITITIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
PFIVFRLMEIWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
TTYLEVQTSEPLGT
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgcccaccgtggatgacattctggagcaggttggggagtttggctggttccagaagcaa
gccttcctcatcctatgcctgctgtcggctgcctttgcgcccatctgtgtgggcatcgtc
ttcctgggtttcatacctgaccaccactgccagagccctggggtggctgagctgagccag
cgctgcggctggagccctgcggaggagctgaactacacagtgccaggcctggggcccgcg
ggcgaggccttccttgcccagtgcaggcgctatgaagtggactggaaccagagcgccctc
agctgtgtagaccccctggctagcctggccaccaacagaagccacctgccgctgggtccc
tgccaggatggctgggtgtatgacacgcctggctcttccattgtcactgagttcaacctg
gtgtgtgctgactcctggaagctggacctctttcagtcctgtttgaatgctggcttcttc
tttggctctctgggtgttggctactttgcagacaggtttggccgtaagctgtgtctcctg
ggcaccgtgctggtcaatgccgtgtcgggcgtgctcttggccttcgcgcccaactacgtg
tccatgctactgttccgcctgctgcagggcctggtcagcaagggcaactggatggccggc
tacaccctaatcacagaatttgttggctcgggctccagaagaacggtggcgatcatgtac
cagatggccttcacggtggggttggtggcgcttaccgggctggcctacgccctgcctcac
tggcgctggctgcagctggcagtctccctgcctacgttcctcttcctgctctactactgg
tgtgtgccggagtcccctcggtggctgttatcgcaaaaaagaaacactgaagcaataaag
ataatggaccacatcgctcaaaagaatgggaagttgcctcctgctgatttaaagatgctc
tccctcaaagaggatgtcaccgaaaagctgagcccttcgtttgcagacctgttccgcatg
ccgcgcctgaggaaacacaccttcatcctgatgtacctgtggttcaccgcctctgttctc
tatcaggggctcatcctgcacatgggcgccaccagcgggaacctctacctggatttcctt
tactccgctctggtcgaattcccgggggccttcataaccctcatcaccattgaccgcgtg
ggccgcatctaccccacagccgtgtcaaatctgttggcgggggcagcctgcctcttcatg
atttttatctcacctgacctgcactggttaaacctcataatcatgtgtgttggccgaatg
ggaatcaccattacaatacaaatgatctgcctggtgaatgctgagctataccccacattc
gtcaggaatctcggagtgatggtgtgttcctccctgtgtgacataggtgggataatcacc
cccttcatagtcttcaggctgatggagatttggcaagccttgcccctcattttgtttgcg
gtgttgggcctgcttgccgcgggagtgacgctacttcttccggagaccaagggggtcgct
ttgccagagaccatgaaggacgccgagaaccttgggagaaaagcaaagcccaaagaaaac
acaacttaccttgaggtccaaacctcagaacccttgggcacctga

KEGG   Pongo abelii (Sumatran orangutan): 100438264
Entry
100438264         CDS       T01416                                 

Gene name
SLC22A3
Definition
(RefSeq) solute carrier family 22 member 3
  KO
K08200  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100438264 (SLC22A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100438264 (SLC22A3)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   100438264 (SLC22A3)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    100438264 (SLC22A3)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 100438264
NCBI-ProteinID: XP_002817595
Ensembl: ENSPPYG00000017152
UniProt: H2PKT2 A0A6D2VVY4
LinkDB
Position
6
AA seq 556 aa
MPSFDEALQRAGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALA
ERCGWSPEEEWNRTAPASRGPEPPERRGRCQRYLLEAANDSASATGALSCSDPLAAFPNR
SAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYG
RIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGVFGKGTWMTCYVIVTEIVGSKQRR
IVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKK
GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFT
SAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA
CLVTAFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFG
GIIAPFLLFRLAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHS
CKCGRNKKTPVSSSHL
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgccctccttcgacgaggcgctgcagcgggcgggcgagttcgggcgcttccagaggcgc
gtgttcctgctgctgtgcctgacgggcgtcaccttcgccttcctcttcgtcggcgtggtc
ttcctgggcacgcagcccgaccactactggtgccgcgggccaagtgccgcggctctggcc
gagcgctgcggctggagcccggaggaggagtggaaccgcacggcgcccgcctcccgcggc
cctgagccccccgagcgccgcggccgctgccagcgctacctcctggaggcggccaacgac
agcgcctccgccactggcgctctcagctgctcggacccgctcgccgccttccccaaccgt
tcggcgccccttgtgccgtgccgcggcggctggcgctacgcccaggcccactccaccatc
gtcagcgagtttgaccttgtctgtgtcaatgcgtggatgctggacctcacccaagccatc
ctgaacctcggcttcctgactggagcattcaccttaggctatgcagcagacaggtatggc
aggatcgtcatttacttgctatcctgccttggtgttggtgtcactggggttgtggtggcc
tttgcaccaaacttccctgtgtttgtgatcttccgcttcctgcaaggtgtgtttggaaag
gggacatggatgacttgctacgtgattgtgacagaaatagtaggttcgaaacaaaggagg
attgtgggaatcgtgattcaaatgttctttacccttggaatcattattctccctggaatt
gcctacttcatccccaattggcaaggaatccagttagccatcacgctgcccagctttctc
ttcctcctttattactgggtggtccccgagtctccccgttggctgattactcggaagaaa
ggagataaagcattacagatcctgagacgcattgctaagtgcaatgggaaatacctctca
tcaaattactcagagatcactgttacagatgaggaagttagtaatccatcctttttagat
ctggtgagaactccccaaatgaggaaatgcacacttattcttatgtttgcttggttcaca
agcgcagtggtatatcaaggacttgtcatgcgcctgggaattataggaggcaacctctat
atagactttttcatctcgggcgtggtggaactgccgggagctctcttgatcttactaacc
attgagcgccttggacgacgcctcccctttgcggcaagcaatatagtggcgggggtggca
tgccttgtcactgcgttcttaccagaaggaatagcatggttgaggaccacagtggctaca
ttgggaagactagggataaccatggcctttgaaattgtttatttggtaaattcagaattg
tacccaacaacattacgaaattttggagtttcgctctgttcaggtctgtgtgattttggg
ggaatcatagccccgtttctgctctttcggctagcagccgtgtggctagaactacctctg
atcatctttggtatcctggcatccatctgtggtggcctcgtgatgcttttgcctgaaacc
aagggtattgccttgccagagacagtggatgatgtagaaaaacttggcagtccacattcc
tgtaaatgtggcaggaataagaaaaccccagtttccagctctcacctttga

KEGG   Pongo abelii (Sumatran orangutan): 100443199
Entry
100443199         CDS       T01416                                 

Gene name
SLC44A5
Definition
(RefSeq) choline transporter-like protein 5 isoform X1
  KO
K15377  solute carrier family 44 (choline transporter-like protein), member 2/4/5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100443199 (SLC44A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100443199 (SLC44A5)
   04147 Exosome [BR:pon04147]
    100443199 (SLC44A5)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC44: Choline-like transporter
   100443199 (SLC44A5)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100443199 (SLC44A5)
SSDB
Motif
Pfam: Choline_transpo
Other DBs
NCBI-GeneID: 100443199
NCBI-ProteinID: XP_002810741
Ensembl: ENSPPYG00000001232
UniProt: A0A2J8WQ40
LinkDB
Position
1
AA seq 719 aa
MNDTEKPADTPSQEEDFGDPKTYDPDFKGPVANRSCTDVLCCMIFLLCIIGYIVLGLVAW
VHGDPRRAAYPTDSQGHFCGQKGTPNENKTILFYFNLLRCTSPSVLLNLQCPTTQICVSK
CPEKFLTYVEMQLLYTKDKSYWEDYRQFCKTTAKPVKSITQLLLDDDCPTAIFPSKPFLQ
RCFPDFSTKNGTLTIGSKMVFQDGNGGTRSVIELRDAANGINKLLDAKSLGLKVFEDYAT
TWYWILIGLTIAMVLSWIFLILLRFIAGCLFWVFMIGVIGIIGYGIWHSYQQYTNLQERP
SSVLTIYDIGIQTNISMYFELQQTWFIFMIILCIIEVIVILMLIFLRNRIRVAIILLKEG
SKAIGYIPSTLVYPALTFILLSICICYWVVTAVFLATSGVPVYKVIAPEGHCIHENQTCD
PEIFHTTEIAKACPGALCNFAFYGGKSLYHQYIPTFHVYNLFVFLWLINFVIALGQCALA
GAFATYYWAMKKPDDIPRYPLFTAFGRAIRYHTGSLAFGSLIIALIQMFKIVLEYLDHRL
KRTQNTLSKFLQCCLRCCFWCLENAIKFLNRNAYIMIAIYGRNFCRSAKDAFNLLMRNVL
KVAVTDEVTYFVLFLGKILVAGSIGVLAFLFFTQRLPVIAQGPASLNYYWVPLLTVIFGS
YLIAHGFFSVYAMCVETIFICFCEDLERNDGSTEKPYFITPNLHGILIKKQLVPQKQKE
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgaatgacacagaaaaaccagcagatactccctctcaggaagaggactttggtgatcca
aagacatatgacccagatttcaaggggcctgttgccaacaggagttgtacagatgttctg
tgctgtatgatcttcctactgtgcattattggctacattgttttaggacttgtggcctgg
gtacatggggaccccagaagagcagcctatcctacagacagccagggccacttttgtggc
cagaagggcacccccaatgagaacaagaccattttgttttattttaacctgttacgctgt
accagtccctccgtgttgctaaacctacagtgccctaccacacagatctgtgtctccaag
tgcccagaaaaatttttaacctatgtggaaatgcaacttttgtacacaaaagacaaaagc
tactgggaagactaccgtcagttctgtaagaccactgctaagcctgtgaagtctatcaca
caacttttactggatgatgattgtccaacagcgatttttccaagcaaaccttttctccag
agatgtttccctgacttctctaccaaaaatggcactttaacaataggaagtaagatggtg
tttcaagatggaaatggagggacaagaagtgttatagaactcagggatgctgcaaatggt
atcaataaacttcttgatgcaaagtcacttggattgaaagtgtttgaagactatgcaaca
acttggtattggattctcattggcctgactatcgccatggtccttagttggatatttttg
atacttctgaggttcatagctggatgcctcttctgggtcttcatgattggtgtgattgga
attataggttatggaatatggcacagttaccagcagtacaccaatcttcaggaacgccca
agttctgtattaactatctatgacatcgggattcagactaacataagcatgtactttgaa
ctgcaacaaacatggttcatatttatgataatactctgcatcattgaagtgattgtcatc
ctcatgctgatcttcctcaggaatcgaatccgagtcgccattatcctgctgaaggaagga
agcaaagccattggatacattcctagtacattagtctatccagctttaactttcattttg
ctctcaatctgcatttgctactgggttgtgacagcagttttcttggcgacatcaggggta
cctgtatacaaagtcatagctccagaggggcattgtatacatgaaaatcaaacctgtgac
ccagagatttttcatacaactgaaattgccaaagcttgccctggggctctgtgtaacttt
gctttctatggtggaaagagcttgtaccatcaatacatccctaccttccatgtatacaac
ttatttgtctttctctggcttataaacttcgtcattgcattgggtcagtgtgcccttgct
ggtgcattcgctacttattactgggccatgaaaaaacctgatgacatcccacgatatcca
ctttttactgcatttggacgagccatacgatatcatacaggatccctagcatttggatct
ttaattattgcattaattcaaatgtttaaaattgtcctagaatacttggaccaccgtctt
aaacgtacccagaacacattgtctaaattcctgcaatgctgcctgagatgctgcttctgg
tgtttggaaaatgcaataaagtttttaaacagaaatgcctatattatgattgcaatatat
ggcagaaacttctgcaggtcagcaaaagatgctttcaatctgctgatgagaaatgtttta
aaagttgcagttactgatgaagttacatactttgtattattcctggggaaaattctagtt
gctggaagtataggtgttctggccttcctattcttcacacaaagactgccagtgattgca
caaggaccagcatctttaaattactactgggtacctttgctgacggtcatttttgggtct
tacctgattgcacatgggttcttcagcgtctatgcaatgtgtgttgaaacaattttcatc
tgcttctgtgaagatctggaaagaaatgatggatctacagaaaaaccctacttcataacc
cctaacctgcacggaattctgatcaagaagcaactagttccccagaagcagaaagagtag

KEGG   Pongo abelii (Sumatran orangutan): 100449286
Entry
100449286         CDS       T01416                                 

Gene name
SLC44A1
Definition
(RefSeq) choline transporter-like protein 1 isoform X1
  KO
K06515  solute carrier family 44 (choline transporter-like protein), member 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100449286 (SLC44A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100449286 (SLC44A1)
   04090 CD molecules [BR:pon04090]
    100449286 (SLC44A1)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC44: Choline-like transporter
   100449286 (SLC44A1)
CD molecules [BR:pon04090]
 Proteins
  100449286 (SLC44A1)
SSDB
Motif
Pfam: Choline_transpo
Other DBs
NCBI-GeneID: 100449286
NCBI-ProteinID: XP_024107897
LinkDB
Position
9
AA seq 718 aa
MGCCSSASAAQSSKREWKPLEDRSCTDIPWLLLFILFCIGMGFICGFSIATGAAARLVSG
YDSYGNICGQKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQE
LKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNI
SCYAKFAEALITFVSDNSVLHRLISGVMTSKEIILGLCLLSLVLSMILMVIIRYISRVLV
WILTILVILGSLGGTGVLWWLYAKQRRSPKETVTPEQLQIAEDNLRALLIYAISATVFTV
ILFLIMLVMRKRVALTIALFHVAGKVFIHLPLLVFQPFWTFFALVLFWVYWIMTLLFLGT
TGSPVQNEQGFVEFKISGPLQYMWWYHVVGLIWISEFILACQQMTVAGAVVTYYFTRDKR
NLPFTPILASVNRLIRYHLGTVAKGSFIITLVKIPRMILMYIHSQLKGKENACARCVLKS
CICCLWCLEKCLNYLNQNAYTATAINSTNFCTSAKDAFVILVENALRVATINTVGDFMLF
LGKVLIVCSTGLAGIMLLNYQQDYTVWVLPLIIVCLFAFLVAHCFLSIYEMVVDVLFLCF
AIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADARELKPMVGGDEEVAALQ
EFHFHFLSLSVFTDCTSSGEAFVICITQDVLLFLFVCLPITWMAEFLSQLRPPSVKVS
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgggctgctgcagctccgcctccgccgcgcagagctccaaacgagaatggaagccgctg
gaggaccgtagctgcacagacataccatggctgctgctcttcattctcttctgcattggg
atgggatttatttgtggcttttcaatagcaacaggtgcagcagcaagactagtgtcagga
tacgacagctatggaaatatctgtgggcagaaaaatacaaagttggaagcaataccaaac
agtggcatggaccacacccagcggaagtatgtattctttttggatccatgcaacctggac
ttgataaaccggaagattaagtctgtagcactgtgtgtagcagcatgtccaaggcaagaa
ctgaaaactctgagtgatgttcagaagtttgcggagataaatggttcagcactatgtagc
tacaacctaaagccttctgaatacactacatctccaaaatcttctgttctctgccccaaa
ctaccagttccagcgagtgcacctattccattcttccatcgctgtgctcctgtgaacatt
tcctgctatgccaagtttgcagaggccctgatcacctttgtcagtgacaatagtgtctta
cacaggctgattagtggagtaatgaccagcaaagaaattatattgggactttgcttgtta
tcactagttctatccatgattttgatggtgataatcaggtacatatcaagagtacttgtg
tggatcttaacgattctggtcatactcggttcacttggaggcacaggtgtactatggtgg
ctgtatgcaaagcaaagaaggtctcccaaagaaactgttactcctgagcagcttcaaata
gctgaagacaatcttcgggccctcctcatttatgccatttcagctacagtgttcacagtg
atcttattcctgataatgttggttatgcgcaaacgtgttgctcttaccatcgccttgttc
cacgtagctggcaaggtcttcattcacttgccactgctagtcttccaacccttctggact
ttctttgctcttgtcttgttttgggtgtactggatcatgacacttctttttcttggcact
accggcagtcctgttcagaatgagcaaggctttgtggagttcaaaatttctgggcctctg
cagtacatgtggtggtaccatgtggtgggcctgatttggatcagtgaatttattctagca
tgtcagcagatgacagtggcaggagctgtggtaacatactattttactagggataaaagg
aatttgccatttacacctattttggcatcagtaaatcgccttattcgttaccacctaggt
acggtggcaaaaggatctttcattatcacattagtcaaaattccgcgaatgatcctcatg
tatattcacagtcagctcaaaggaaaggaaaatgcttgtgcacgatgtgtgctgaaatct
tgcatttgttgcctttggtgtcttgaaaagtgcctaaattatttaaatcagaatgcatac
acagccacagctatcaacagcaccaacttctgcacctcagcaaaggatgcctttgttatt
ctggtggagaatgctttgcgagtggctaccatcaacacagtaggagattttatgttattc
ctcggcaaggtgctgatagtctgcagcacaggtttagctgggattatgctgctcaactac
cagcaggactacacagtatgggtgctgcctctgatcatcgtctgcctctttgctttccta
gtcgctcattgcttcctgtctatttatgaaatggtagtggatgtattattcttgtgtttt
gccattgatacaaaatacaatgatgggagccctggcagagaattctatatggataaagtg
ctgatggagtttgtggaaaacagtaggaaagcaatgaaagaagctggtaagggaggcgtt
gctgatgccagagagctaaagccgatggtaggtggagatgaggaggtggctgccctccaa
gaatttcactttcacttcctctctctctctgtcttcactgactgcacttcttcaggagaa
gcttttgttatctgtatcacgcaggacgtgctgctctttctgtttgtgtgcttacccatc
acttggatggcagaattcttgtcacaactgagaccaccttctgtaaaagtaagctga

KEGG   Pongo abelii (Sumatran orangutan): 100449383
Entry
100449383         CDS       T01416                                 

Gene name
SLC22A5
Definition
(RefSeq) solute carrier family 22 member 5 isoform X1
  KO
K08202  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 4/5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100449383 (SLC22A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100449383 (SLC22A5)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   100449383 (SLC22A5)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    100449383 (SLC22A5)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 100449383
NCBI-ProteinID: XP_024103525
Ensembl: ENSPPYG00000015760
LinkDB
Position
5
AA seq 557 aa
MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRCRVPDAANLSS
AWLNHSVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFS
QDIYLSTIVTEWNLVCEDDWKAPLTISLFFVGVLLGSFISGQLSDRFGRKNVLFVTMGMQ
TGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEILGKSVRIIFSTLGVCIFYA
FGYMVLPLFAYFIRDWRMLLVALTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRKA
AKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWNIRMVTIMSIMLWMTISVGYFG
LSLDTPNLHGDIYVNCFLSAMVEVPAYVLAWLLLQYLPRRYSMATALFLGGSVLLFVQLV
PPDLYYLATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYF
VYLGAYDRFLPYILMGSLTILTAILTLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSRTR
MLKDGQERPAILKSTAF
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgcgagactacgacgaggtgaccgccttcctgggcgagtgggggcccttccagcgcctc
atcttcttcctgctcagcgccagcatcatccccaatggcttcaccggcctgtcctcagtg
ttcctgatagcgaccccggagcaccgctgccgggtgccggacgccgcgaacctgagcagc
gcctggctcaaccacagtgtcccactgcggctgcgggacggccgcgaggtgccccacagc
tgccgccgctaccggctcgccaccatcgccaacttctcggcgctcgggctggagccgggg
cgcgacgtggacctggggcagctggagcaggagagctgcctggatggctgggagttcagt
caggacatctacctgtccaccattgtgaccgagtggaacctggtgtgtgaggacgactgg
aaggccccactcacgatctccttgttcttcgtgggtgtgctgttgggctccttcatttca
gggcagctgtcagacaggtttggccggaagaatgtgctgttcgtgaccatgggcatgcag
acaggcttcagcttcctgcagatcttctcgaagaattttgagatgtttgtcgtgctgttt
gtccttgtaggcatgggccagatctccaactatgtggcagcatttgtcctggggacagaa
attcttggcaagtcagttcgtataatattctctacgttaggagtgtgcatattttatgca
tttggctacatggtgctgccactgtttgcttacttcatccgagactggcggatgctgctg
gtggcgctgacgatgccgggggtgctgtgcgtggcactctggtggttcatccctgagtcc
ccccgatggctcatctctcagggacgatttgaagaggcagaggtgatcatccgcaaggct
gccaaagccaatgggattgttgtgccttccactatctttgacccaagtgagttacaagac
ctaagttccaagaagcagcagtcccacaacattctggatctgcttcgaacctggaatatc
cggatggtcaccatcatgtccataatgctgtggatgaccatatcagtgggctatttcggg
ctttcgcttgatactcctaacttgcatggggacatctatgtgaactgcttcctttcagcg
atggttgaagtcccagcatatgtgttggcctggctgctgctgcaatatttgccccggcgc
tattccatggccactgccctcttcctgggtggcagtgtccttctcttcgtgcagctggta
cccccagacttgtattatttggctacagtcctggtgatggtgggcaagtttggagtcaca
gctgccttttccatggtctacgtgtacacagccgagctgtatcccacagtggtgagaaac
atgggtgtgggagtcagctccacagcatcccgcctgggcagcatcctgtctccctacttc
gtttacctcggtgcctacgaccgcttcctgccctacattctcatgggaagtctgaccatc
ctgacagccatcctcaccttgtttctcccagagagcttcggtaccccactcccggacacc
attgaccagatgctaagagtcaaaggaatgaaacacagaaaaactccaagccgcacaagg
atgttaaaagatggtcaagaaaggcccgcaatccttaaaagcacagccttctaa

KEGG   Pongo abelii (Sumatran orangutan): 100455825
Entry
100455825         CDS       T01416                                 

Gene name
SLC44A3
Definition
(RefSeq) choline transporter-like protein 3 isoform X1
  KO
K15282  solute carrier family 44 (choline transporter-like protein), member 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100455825 (SLC44A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100455825 (SLC44A3)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC44: Choline-like transporter
   100455825 (SLC44A3)
SSDB
Motif
Pfam: Choline_transpo
Other DBs
NCBI-GeneID: 100455825
NCBI-ProteinID: XP_024101469
Ensembl: ENSPPYG00000001138
LinkDB
Position
1
AA seq 653 aa
MHCLGAEYLVSAEGAPRQREWRPQIYRKCTDTAWLFLFFLFWTGLVFIMGYSVVAGATGR
LLFGYDSFGNVCGKKNSPVEGAPLSGQDMTLKKHVFFMNSCNLEVKGTRLNRMALCVSNC
PEEQLDSLEEVQLFANTSGSFLCVYSLNSFNYTHSPKADSLCPRLPVPPSKSFPLFNRCV
PQTPECYSLFASVLINDVDTLHRILSGIMSGRDTILGLCILALALSLAMMFTFRFITTLL
VHIFISLVILGLLFVCGVLWWLYYDYTNDLSIELDTERENMKCVLGFAIVSTGITAVLLI
LIFVLRKRIKLTVELFQITNKAISSAPFLLFQPLWTFAILIFFWVLWVAVLLSLGTAGAA
QVMEGGQVEYKPLSGIRYMWSYHLIGLIWTSEFILACQQMTIAGAVVTCYFNRSKNDPPD
RPILSSLSILFFYHQGTVVKGSFLISVVRIPRIIVMYMQNALKEQQHGALSRYLFRCCYC
CFWCLDKYLLHLNQNAYTTTAINGTDFCTSAKDAFKILSKNSSHFTSINCFGDFIIFLGK
VLVVCFTVFGGLMAFNYNRAFQVWAVPLLLVAFFAYLVAHSFLSVFETVLDALFLCFAVD
LETNDGSSEKPYFMDQEFLSFVKRSNKLNNTRAQQDKHSLRNEEGTELQAIVR
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgcactgcctgggcgccgagtacctggtttctgcagaaggagcccctaggcaaagggag
tggcgaccccagatttataggaaatgcacagatacggcgtggttattcctgttctttctc
ttttggactggtttggtgtttatcatgggctactcggtggtggctggagccacgggaaga
ctcctcttcggctatgacagctttggcaatgtgtgtggcaagaagaactcccccgtggaa
ggggcccccctttcagggcaggacatgaccctaaaaaaacacgtgttctttatgaattcc
tgcaacctggaagtcaaaggtacgcggctcaaccgcatggccctctgtgtatccaactgc
cctgaagagcagcttgactccctggaagaggtccagctctttgcaaacaccagtgggtcc
ttcctgtgtgtttatagtttgaattccttcaactacacccacagtccaaaagcagactca
ctgtgtcccaggctaccagttcctccaagcaagtcatttcccttatttaaccgatgtgtc
cctcaaacacctgagtgctactccctatttgcatctgttttgataaatgatgttgacacc
ctccaccgaattctaagtggaatcatgtcgggaagagatacaatccttggcctgtgtatc
ctcgcattagccttgtctttggccatgatgtttaccttcagattcatcaccacccttctg
gttcacattttcatttcattggttattttgggattgttgtttgtctgcggtgttttatgg
tggctgtattatgactataccaatgatctcagcatagaattggacacagaaagggaaaat
atgaagtgcgtgctggggtttgctatcgtatctacaggcatcacggcagtgctgctcatc
ttgatttttgttctcagaaagagaataaaattgacagttgagcttttccaaatcacaaat
aaagccatcagcagtgctcccttcctgctgttccagccactgtggacatttgccatcctc
attttcttctgggtcctctgggtggctgtgctgctgagcctgggaactgcaggagctgcc
caggttatggaaggtggccaagtggaatataagcccctttcgggcattcggtacatgtgg
tcgtaccatttaattggcctcatctggactagtgaattcatccttgcgtgccagcaaatg
actatagctggggcagtggttacttgttatttcaacagaagtaaaaatgaccctcctgat
cgtcccatcctttcgtctctctccattctcttcttctaccatcaaggaaccgttgtgaaa
gggtcatttttaatctctgtggtgaggattccaagaatcattgtcatgtacatgcaaaac
gcactgaaagaacagcagcatggtgcattgtccaggtacctgttccgatgctgctactgc
tgtttctggtgtcttgacaaatacctgctccatctcaaccagaatgcatatactacgact
gctattaatgggacagatttctgtacatcagcaaaagatgcattcaaaatcttgtccaag
aactcaagtcactttacatctattaactgctttggagacttcataatttttctaggaaag
gtgttagtggtgtgtttcactgtttttggaggactcatggcttttaactacaatcgggca
ttccaggtgtgggcagtccctctgttattggtagctttttttgcctacttagtagcccat
agttttttatctgtgtttgaaaccgtgctggatgcacttttcctgtgttttgctgttgat
ctggaaacaaatgatggatcgtcagaaaagccctactttatggaccaagaatttctgagt
ttcgtaaaaaggagcaacaaattaaacaatacaagggcacagcaagacaagcactcatta
aggaatgaggaaggaacagaactccaggccattgtgagatag

KEGG   Pongo abelii (Sumatran orangutan): 100456472
Entry
100456472         CDS       T01416                                 

Gene name
SLC22A4
Definition
(RefSeq) solute carrier family 22 member 4 isoform X1
  KO
K08202  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 4/5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100456472 (SLC22A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100456472 (SLC22A4)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   100456472 (SLC22A4)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    100456472 (SLC22A4)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 100456472
NCBI-ProteinID: XP_024103527
Ensembl: ENSPPYG00000015759
LinkDB
Position
5
AA seq 551 aa
MRDYDEVIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCRVPDAANLSS
AWRNNSVPLRLRDGREVPHSCRRYRLAIIANFSALGLEPGRDVDLGQLEQESCLDGWEFS
QDVYLSTVVTEWNLVCEDNWKVPLTTSLFFVGVLLGSFVSGQLSDRFGRKNVLFATMAVQ
TGFSFLQIFSISWEMFTVLFVIVGMGQISNYVVAFILGTEILGKSVRIIFSTLGVCTFFA
VGYMLLPLFAYFIRDWRMLLLALTVPGVLCVPLWWFIPESPRWLISQRRFREAEDIIQKA
AKMNNIAVPAVIFDSVEELNPLKQQKAFILDLFRTRNIAIMTIMSLLLWMLTSVGYFALS
LDAPNLHGDAYLNCFLSALIEIPAYITAWLLLRTLPRRYIIAAVLFWGGGVLLFIQLVPV
DYYFLSIGLVMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGVTSMASRVGSIIAPYFVY
LGAYNRMLPYIVMGSLTVLIGILTLFFPESLGMTLPETIEQMQKVKWFRSGKKTRDSMET
EENPKVLITAF
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgcgggactacgacgaggtgatcgccttcctgggcgagtgggggcccttccagcgcctc
atcttcttcctgctcagcgccagcatcatccccaatggcttcaatggtatgtcagtcgtg
ttcctggcggggaccccggagcaccgctgtcgagtgccggacgccgcgaacctgagcagc
gcctggcgcaacaacagtgtcccgctgcggctgcgggacggccgcgaggtgccccacagc
tgccgccgctaccggctcgccatcatcgccaacttctcggcgctcgggctggagccgggg
cgcgacgtggacctggggcagctggagcaggagagctgcctggatggctgggagttcagc
caggacgtctacctgtccaccgtcgtgaccgagtggaatctggtgtgtgaggacaactgg
aaggtgcccctcaccacctccctgttcttcgtaggcgtgcttctcggctccttcgtgtcc
gggcagctgtcagacaggtttggcaggaagaacgttctcttcgcaaccatggctgtacag
actggcttcagcttcctgcagattttctccatcagctgggagatgttcactgtgttattt
gtcatcgtgggcatgggccagatctccaactatgtggtagccttcatactaggaacagaa
attcttggcaagtcagttcgtattatattctctacattaggagtgtgcacattttttgca
gttggctatatgctgctgccactgtttgcttacttcatcagagactggcggatgctgctg
ctggcgctgacggtgccgggagtgctgtgtgtcccgctgtggtggttcattcctgaatct
ccccgatggctgatatcccagagaagatttagagaggctgaagatatcattcaaaaagct
gcaaaaatgaacaacatagctgtaccagcagtgatatttgattctgtggaggagctaaat
cccctgaagcagcagaaagctttcattctggacctgttcaggactcggaatattgccata
atgaccattatgtctttgctgctatggatgctgacctcagtgggttactttgcgctgtct
ctggatgctcctaatttacatggagatgcttacctgaactgtttcctctctgccttgatt
gaaattccagcttacattacagcctggctgctattgcgaaccctgcccaggcgttatatc
atagctgcagtactgttctggggaggaggtgtgcttctcttcattcaactggtacctgtg
gattattacttcttatccattggtctggtcatgctgggaaaatttgggatcacctctgct
ttctccatgctgtatgtcttcactgctgagctctacccaaccctggtcaggaacatggcg
gtgggggtcacatccatggcctccagagtgggcagcatcattgccccctactttgtttac
ctcggtgcttacaacagaatgctgccctacatcgtcatgggtagtctgactgtcctgatt
ggaatcctcaccctttttttccctgaaagtttgggaatgactcttccagaaaccatagag
cagatgcagaaagtgaaatggttcagatctgggaaaaaaacaagagactcaatggagaca
gaagaaaatcccaaggttctaataactgcattctga

KEGG   Pongo abelii (Sumatran orangutan): 100457648
Entry
100457648         CDS       T01416                                 

Gene name
SLC5A7
Definition
(RefSeq) high affinity choline transporter 1 isoform X1
  KO
K14387  solute carrier family 5 (high affinity choline transporter), member 7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04725  Cholinergic synapse
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100457648 (SLC5A7)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100457648 (SLC5A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100457648 (SLC5A7)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   100457648 (SLC5A7)
SSDB
Motif
Pfam: SSF
Other DBs
NCBI-GeneID: 100457648
NCBI-ProteinID: XP_024098334
Ensembl: ENSPPYG00000012131
LinkDB
Position
2A
AA seq 580 aa
MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDVHISVIISALIATLYTLVGG
LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHTKYQKPWLGTVDSSEVYSW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAVPAILIGAIGASTDW
NQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK
TLAMVMSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLD
ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggctttccatgtggaaggactgatagctatcatcgtgttctaccttctaattttgctg
gttggaatatgggctgcctggagaaccaaaaacagtggcagcgcagaagagcgcagtgaa
gccatcatagttggtggccgagatattggtttattggttggtggatttaccatgacagct
acctgggtcggaggagggtatatcaatggcacagctgaagcagtttatgtaccaggttat
ggcctagcttgggctcaggcaccaattggatattctcttagtctgattttaggtggcctg
ttctttgcaaaacctatgcgttcaaaggggtatgtgaccatgttagacccgtttcagcaa
atctatggaaaacgcatgggcggactcctgtttatccctgcactgatgggagaaatgttc
tgggctgcagcaattttctctgctttgggagccaccatcagcgtgatcatcgatgtggat
gtgcacatttctgtcatcatctctgcgctcattgccactctgtacacactggtgggaggg
ctctattctgtggcctacactgatgtcgttcagctcttttgcatttttgtggggctgtgg
atcagcgtcccctttgcattgtcacatcctgcagtcgcagacatcgggttcactgctgtg
cataccaaataccaaaagccgtggctgggaactgttgactcatctgaagtctactcttgg
cttgatagttttctgttgttgatgctgggtggaatcccatggcaagcgtacttccagagg
gttctctcttcatcctcagccacttatgctcaagtgctgtccttcctggcagctttcggg
tgcctggtgatggctgtcccagccatactcattggggccattggagcatcaacagactgg
aaccagactgcatatgggcttccagatcccaagactacagaagaggcagacatgatttta
ccaattgttctgcagtatctctgccctgtgtatatttctttctttggtcttggtgccgtt
tctgctgctgttatgtcatcagcagattcttccatcttgtcagcaagttccatgtttgca
cggaacatctaccagctttccttcagacaaaatgcttcggacaaagaaatcgtttgggtt
atgcgaatcacagtgtttgtgtttggagcatctgcaacagccatggccttgctgacgaag
actgtgtatgggctctggtacctcagttctgaccttgtttacatcgttatcttcccccag
ctgctttgtgtactctttgttaagggaaccaacacctatggggccgtggcaggttatgtt
tctggcctcttcctgagaataactggaggggagccatatctgtatcttcagcccttgatc
ttctaccctggctattaccctgatgataatggtatatataatcagaaatttccatttaaa
acacttgccatggttatgtcattcttaaccaacatttgcatctcctatctagccaaatat
ctatttgaaagtggaaccttgccacctaaattagatgtatttgatgctgttgttgcaaga
cacagtgaagaaaacatggataagacaattcttgtcaaaaatgaaaatattaaattagat
gaacttgcacttgtgaagccacgacagagcatgaccctcagctcaactttcaccaataaa
gaggccttccttgatgttgattccagtccagaagggtctgggactgaagataacttacag
tga

DBGET integrated database retrieval system