KEGG   Pongo abelii (Sumatran orangutan): 100171509
Entry
100171509         CDS       T01416                                 

Gene name
SLC7A7
Definition
(RefSeq) Y+L amino acid transporter 1
  KO
K13867  solute carrier family 7 (L-type amino acid transporter), member 7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    100171509 (SLC7A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100171509 (SLC7A7)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100171509 (SLC7A7)
SSDB
Motif
Pfam: AA_permease_2 AA_permease TMEM237 p53-inducible11
Other DBs
NCBI-GeneID: 100171509
NCBI-ProteinID: NP_001124665
Ensembl: ENSPPYG00000005643
UniProt: Q5RFC6
LinkDB
Position
14
AA seq 511 aa
MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPK
GVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRL
WTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVRRG
TLVQDIFTYAKVLALIAVIVAGIVRPGQGASTHFENSFEGSSFAAGDIALALYSALFSYS
GWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTF
ADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVP
SLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFF
PIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIVRVPEHKRPLYLRRIVGSAT
RYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggttgacagcactgagtatgaagtggcctcccagcctgaggtggaaacctcccctttg
ggtgatggggccagcccagggccggagcaggtaaagctgaagaaggagatctcactgctt
aacggcgtgtgcctgattgtggggaacatgattggctcgggcatctttgtttcccccaag
ggtgtgctcatatacagtgcctcctttggtctctctctggtcatctgggctgtcgggggc
ctcttctccgtctttggggccctttgttatgcggaactgggcaccaccattaagaaatct
ggggccagctatgcctatatcctggaggcctttggaggattccttgctttcatcagactc
tggacctccctgctcatcattgagcccaccagccaggccatcattgccatcacctttgcc
aactacatggtacagcctctcttcccgagctgcttcgccccttatgctgccagccgcctg
ctggctgctgcctgcatctgtctcttaaccttcattaactgtgcctatgtcagacgggga
accctggtacaagatattttcacctatgctaaagtattggcactgatcgcggtcatcgtt
gcaggcattgttagacctggccagggagcctccactcattttgagaattcctttgagggt
tcatcatttgcagcgggtgacattgccctggcactgtactcagctctgttctcctactca
ggctgggacaccctcaactatgtcactgaagagatcaagaatcctgagaggaacctgccc
ctctccattggcatctccatgcccattgtcaccatcatctatatcttgaccaatgtggcc
tattataccgtgctcgacatgagagacatcttggccagtgatgctgttgctgtgactttt
gcagatcagatatttggaatatttaactggataattccactgtcagttgcattatcctgt
tttggtggcctcaatgcctccattgtggctgcttctaggcttttctttgtgggctcaaga
gaaggtcatctccctgatgccatctgcatgatccatgttgagcggttcacaccagtgcct
tctctgctcttcaatggtatcatggcattgatctacttgtgcgtggaagacatcttccag
ctcattaactactacagcttcagctactggttctttgtggggctttctattgtgggtcag
ctttatctgcgctggaaggagcctgatcgacctcgtcccctcaagctcagcgttttcttc
ccgattgtcttctgcctctgcaccatcttcctggtggctgttccactttacagtgatact
atcaactccctcatcggcattgccattgccctctcaggcctgcccttttacttcctcatt
gtcagagtgccagaacataagcgaccgctttacctccgaaggatcgtggggtctgccaca
aggtacctccaggtcctgtgtatgtcagttgctgcagaaatggatttggaagatggagga
gagatgcccaagcaacgggatcccaagtctaactaa

DBGET integrated database retrieval system