KEGG   Pongo abelii (Sumatran orangutan): 100171532
Entry
100171532         CDS       T01416                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04115  p53 signaling pathway
pon04120  Ubiquitin mediated proteolysis
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04218  Cellular senescence
pon04625  C-type lectin receptor signaling pathway
pon04919  Thyroid hormone signaling pathway
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100171532 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100171532 (MDM2)
   04151 PI3K-Akt signaling pathway
    100171532 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100171532 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    100171532 (MDM2)
   04115 p53 signaling pathway
    100171532 (MDM2)
   04218 Cellular senescence
    100171532 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100171532 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100171532 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100171532 (MDM2)
   05202 Transcriptional misregulation in cancer
    100171532 (MDM2)
   05206 MicroRNAs in cancer
    100171532 (MDM2)
   05205 Proteoglycans in cancer
    100171532 (MDM2)
   05203 Viral carcinogenesis
    100171532 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    100171532 (MDM2)
   05220 Chronic myeloid leukemia
    100171532 (MDM2)
   05218 Melanoma
    100171532 (MDM2)
   05219 Bladder cancer
    100171532 (MDM2)
   05215 Prostate cancer
    100171532 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100171532 (MDM2)
   05169 Epstein-Barr virus infection
    100171532 (MDM2)
   05165 Human papillomavirus infection
    100171532 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100171532 (MDM2)
   01522 Endocrine resistance
    100171532 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100171532 (MDM2)
   04121 Ubiquitin system [BR:pon04121]
    100171532 (MDM2)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100171532 (MDM2)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100171532 (MDM2)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100171532 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 100171532
NCBI-ProteinID: NP_001124685
Ensembl: ENSPPYG00000004754
UniProt: Q5RF93
LinkDB
Position
12
AA seq 497 aa
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVL
FYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
SSDSGTSVSENRCHLEGGRDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE
LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGD
WLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEGD
PEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAE
EGFDVPDCKKTIVNDSKESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEF
EREETQDKEESMESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKP
CPVCRQPIQMIVLTYFP
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggtgaggagcaggcaaatgtgcaataccaacatgtctgtacctactgatggtgctgta
accacctcacagattccagcttcggaacaagagaccctggttagaccaaagccattgctt
ttgaagttattaaagtctgttggtgcacaaaaagacacttatactatgaaagaggttctt
ttttatcttggccagtatattatgactaaacgattatatgatgagaagcaacaacatatt
gtatattgttcaaatgatcttctaggagatttgtttggcgtgccaagcttctctgtgaaa
gagcacaggaaaatatataccatgatctacagaaacttggtagtagtcaatcagcaggaa
tcatcagactcaggtacatctgtgagtgagaacaggtgtcaccttgaaggtgggcgtgat
caaaaggaccttgtgcaagagcttcaggaagagaaaccttcatcttcacatttggtttct
agaccatctacctcatccagaaggagagcaattagtgagacagaagaaaattcagatgaa
ttatctggtgaacgacaaagaaaacgccacaaatctgatagtatttccctttcctttgat
gaaagcctggctctgtgtgtaataagggagatatgttgtgaaagaagcagtagcagtgaa
tctacagggacgccatcgaatccggatcttgatgctggtgtaagtgaacattcaggtgat
tggttggatcaggattcagtttcagatcagtttagtgtagaatttgaagttgaatctctc
gactcagaagattatagccttagtgaagaaggacaagaactctcagatgaagatgatgag
gtatatcgagttactgtgtatcaggcaggggagagtgatacagattcatttgaaggagat
cctgaaatttccctagctgactattggaaatgcacttcatgcaatgaaatgaatcccccc
cttccatcacattgcaacagatgttgggcccttcgtgagaattggcttcctgaagataaa
gggaaagataaaggggaaatctctgagaaagccaaactggaaaactcaacacaagctgaa
gagggctttgatgttcctgattgtaaaaaaactatagtgaatgattccaaagagtcatgt
gttgaggaaaatgatgataaaattacacaagcttcacagtcacaagaaagtgaggactat
tctcagccatcaacttctagtagcattatttatagcagccaagaagatgtgaaagagttt
gaaagggaagaaacccaagacaaagaagagagtatggaatccagtttgccccttaatgcc
attgaaccttgtgtgatttgtcaaggtcgacctaaaaatggttgcattgtccatggcaaa
acaggacatcttatggcctgctttacttgtgcaaagaagctaaagaaaaggaataagccc
tgcccagtatgtagacaaccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system