KEGG   Pongo abelii (Sumatran orangutan): 100171534
Entry
100171534         CDS       T01416                                 

Gene name
ZEB1
Definition
(RefSeq) zinc finger E-box-binding homeobox 1
  KO
K09299  zinc finger homeobox protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05202  Transcriptional misregulation in cancer
pon05206  MicroRNAs in cancer
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100171534 (ZEB1)
   05206 MicroRNAs in cancer
    100171534 (ZEB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100171534 (ZEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100171534 (ZEB1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    100171534 (ZEB1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-Di19 zf-C2H2_jaz Homeodomain zf-C2H2_6 zf-C2HE zf-C2H2_2
Other DBs
NCBI-GeneID: 100171534
NCBI-ProteinID: NP_001124687
Ensembl: ENSPPYG00000002189
UniProt: Q5RF91 Q5RE80
LinkDB
Position
10
AA seq 1126 aa
MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDD
LPTDQTVLPGRSGEREGNAKNCWEDDTGKEGQEILGPEAQADEAGCTVKDDECESDAENE
QNHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGY
KRFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRK
FKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVN
GRPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIV
VASGINCSTPLQNGVFTGGGPLQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVA
VDGNVIRQVLENNQANLASKEQETINASPITTRWPFCYFSQSVFLWLIKMEQPKLSSNYS
LEQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCP
GDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKA
YYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKN
NDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQG
YLYTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQ
KDSCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILI
PQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRK
TENGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEK
PYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPS
QGDSDERESLTREEDEDSEKEEEEEDKEMEELQEEKECEKPQGDEEEEEEEEEVEEEEVE
EAENEGEEAKTEGLMKDDRAESQASSLEQKVSESSEQVSEEKTNEA
NT seq 3381 nt   +upstreamnt  +downstreamnt
atggcggatggccccaggtgtaagcgcagaaagcaggcgaacccgcggcgcaataacgtt
acaaattataatactgtggtagaaacaaattcagattcagatgatgaagacaaactccat
attgtggaagaagaaagtgtcacagatgcagctgattgtgaaggtgtaccagaggatgac
ctgccaacagaccagacagtgttaccagggaggagcggtgaaagagaagggaatgctaag
aactgctgggaggatgacacaggaaaggaagggcaagaaatcctggggcctgaagctcag
gcagatgaagcaggatgtacagtaaaagatgatgaatgcgagtcagatgcagaaaatgag
caaaaccacgatcctaatgttgaagagtttctacaacaacaagacactgctgtcattttt
ccggaggcacctgaagaggaccagaggcagggcacaccagaagccagtggtcatgatgaa
aatggaacaccagatgcattttcacaattactcacctgtccatattgtgatagaggctat
aaacgctttacctctctgaaagaacacattaaatatcgtcatgaaaagaatgaagataac
tttagttgctccctgtgcagttacacctttgcatacagaacccaacttgaacgtcacatg
acatcacataaatcaggaagagatcaaagacatgtgacgcagtctgggtgtaatcgtaaa
ttcaagtgcactgagtgtggaaaagctttcaaatacaaacatcacctaaaagagcactta
agaattcacagtggagagaagccatatgaatgcccaaactgcaagaaacgcttttcccat
tctggctcctatagttcacacataagcagtaagaaatgtatcagcttgatacctgtgaat
gggcgaccaagaacaggactcaagacatctcagtgttcttcaccgtctctttcagcatca
ccaggcagtcccacacgaccacagatacggcaaaagatagagaataaaccccttcaagaa
caactttctgttaaccaaattaaaactgaacctgtggattatgaattcaaacccatagtg
gttgcttcaggaatcaactgttcaacccctttacaaaatggggttttcactggtggtggc
ccattacaggcaaccagttctcctcagggcgtggtgcaagctgttgttctgccaacagtt
ggtttggtgtctcccataagtatcaatttaagtgatattcagaatgtacttaaagtggcg
gtagatggtaatgtaataaggcaagtgttggagaataatcaagccaatcttgcatccaaa
gaacaagaaacaatcaatgcttcacccataacaacaaggtggccattctgttatttcagc
caatcagtcttcctttggttgatcaagatggaacaaccaaaattatcatccaactacagt
cttgagcagcctagccaacttcaagttgttcctcaaaatttaaaaaaagaaaatccagtc
gctacaaacagttgtaaaagtgaaaagttaccagaagatcttactgttaagtctgagaag
gacaaaagctttgaagggggggtgaatgatagcacttgtcttctgtgtgatgattgtcca
ggagatattaatgcacttccagaattaaagcactatgacctaaagcaacctactcagcct
cctccactccctgcagcagaagctgagaagcctgagtcctctgtttcatcagctactgga
gatggcaatttgtctcccagtcagccacctttaaagaacctcttgtctctcctaaaagca
tattatgctttgaatgcacaaccaagtgcagaagagctctcaaaaattgctgattcagta
aacctaccactggatgtagtaaaaaagtggtttgaaaagatgcaagctggacagatttca
gtgcagtcttctgaaccatcttctcctgaaccaggcaaagtaaatatccctgccaagaac
aatgatcagcctcaatctgcaaatgcaaatgaaccccaggacagcacagtaaatctacaa
agtcctttgaagatgactaactccccagttttaccagtgggatcaaccaccaatggttcc
agaagtagtacaccatccccatcacctctaaacctttcctcatccagaaatacacagggt
tacttgtacacagctgagggtgcacaagaagagccgcaagtagaacctcttgatctttca
ctaccaaagcaacagggagaattattagaaaggtcaactatcactagtgtttaccagaac
agtgtttattctgtccaggaagaacccttgaacttgtcttgcgcaaaaaaggagccacaa
aaggacagttgtgttacagactcagaaccagttgtaaatgtaatcccaccaagtgccaac
cccataaatatcgctatacctacagtcactgcccagttacccacaatcgtggccattgct
gaccagaacagtgttccatgcttacgagcactagctgccaataagcaaacgattctgatt
ccccaggtggcatacacgtactcaactacggtcagccctgcagtccaagaaccacccttg
aaagtgatccagccaaatggaaatcaggatgaaagacaagatactagctcagaaggagta
tcaaatgtagaggatcagaatgactctgattctacaccgcccaaaaagaaaatgcggaag
acagaaaatggaatgtatgcttgtgatttgtgtgataagatattccaaaagagtagttca
ttattgagacataaatatgaacacacaggtaaaagacctcatgagtgtggaatctgtaaa
aaggcatttaaacacaaacatcatttgattgaacacatgcgattacattctggagaaaag
ccctatcaatgtgacaaatgtggaaagcgcttctcacactctgggtcttattctcaacac
atgaatcatcgctactcctactgtaagagagaagcggaagaacgtgacagcacagagcag
gaagaggcagggcctgaaatcctctcgaatgagcacgtgggtgctagggcatctccctca
cagggcgactcggacgagagagagagtttgacaagggaagaggatgaagacagtgaaaaa
gaggaagaggaggaggataaagagatggaagaattgcaggaagaaaaagaatgtgaaaaa
ccacaaggggatgaggaagaggaggaggaggaagaagaagtggaagaagaagaggtagaa
gaggcagagaatgagggagaagaagcaaaaactgaaggtctgatgaaggatgacagggct
gaaagtcaagcaagcagcttagaacaaaaagtaagcgagagtagtgagcaagtgtctgaa
gaaaagacaaacgaagcctaa

DBGET integrated database retrieval system