KEGG   Pongo abelii (Sumatran orangutan): 100171540
Entry
100171540         CDS       T01416                                 

Gene name
FGFR2
Definition
(RefSeq) fibroblast growth factor receptor 2
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05215  Prostate cancer
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100171540 (FGFR2)
   04014 Ras signaling pathway
    100171540 (FGFR2)
   04015 Rap1 signaling pathway
    100171540 (FGFR2)
   04020 Calcium signaling pathway
    100171540 (FGFR2)
   04151 PI3K-Akt signaling pathway
    100171540 (FGFR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100171540 (FGFR2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100171540 (FGFR2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100171540 (FGFR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100171540 (FGFR2)
   05230 Central carbon metabolism in cancer
    100171540 (FGFR2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100171540 (FGFR2)
   05215 Prostate cancer
    100171540 (FGFR2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100171540 (FGFR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100171540 (FGFR2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100171540 (FGFR2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100171540 (FGFR2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100171540 (FGFR2)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100171540 (FGFR2)
CD molecules [BR:pon04090]
 Proteins
  100171540 (FGFR2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100171540 (FGFR2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Kinase-like Pkinase_fungal DUF1615
Other DBs
NCBI-GeneID: 100171540
NCBI-ProteinID: NP_001124693
UniProt: Q5RF81
LinkDB
Position
10
AA seq 384 aa
MNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVM
AEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQD
GPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYL
ASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFD
RVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMR
DCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSV
FSPDPMPYEPCLPQYPHINGSVKT
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaactccaataccccgctggtgaggataacaacacgcctctcttcaacggcagacacc
cccatgctggcaggggtctccgagtatgaacttccagaggacccaaaatgggagtttcca
agagataagctgacactgggcaagcccctgggagaaggttgctttgggcaagtggtcatg
gcggaagcagtgggaattgacaaagacaagcccaaggaggcggtcaccgtggccgtgaag
atgttgaaagatgatgccacagagaaagacctttctgatctggtgtcagagatggagatg
atgaagatgattgggaaacacaagaatatcataaatcttcttggagcctgcacacaggat
gggcctctctatgtcatagttgagtatgcctctaaaggcaacctccgagaatacctccga
gcccggaggccacccgggatggagtactcctatgacattaaccgtgttcctgaggagcag
atgaccttcaaggacttggtgtcatgcacctaccagctggccagaggcatggaatacttg
gcttcccaaaaatgtattcatcgagatttagcagccagaaatgttttggtaacagaaaac
aatgtgatgaaaatagcagactttggacttgccagagatatcaacaatatagactattac
aaaaagaccaccaatgggcgacttccagtcaagtggatggctccagaagccctgtttgat
agagtatacactcatcagagtgatgtctggtccttcggggtgttaatgtgggagatcttc
actttagggggctcgccctacccagggattcccgtggaggaactttttaagctgctgaag
gaaggacacagaatggataaaccagccaactgcaccaacgaactgtacatgatgatgagg
gactgttggcatgcagtgccctcccagagaccaacgttcaagcagttggtagaagacttg
gatcgaattctcactctcacaaccaatgaggaatacttggacctcagccaacctctcgaa
cagtattcacctagttaccctgacacaagaagttcttgttcttcaggagatgattctgtt
ttttctccagaccccatgccttacgaaccatgccttcctcagtatccacacataaacggc
agtgttaaaacatga

DBGET integrated database retrieval system