KEGG   Pongo abelii (Sumatran orangutan): 100171550
Entry
100171550         CDS       T01416                                 

Gene name
NCK1
Definition
(RefSeq) cytoplasmic protein NCK1
  KO
K07365  NCK adaptor protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04360  Axon guidance
pon04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100171550 (NCK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100171550 (NCK1)
  09158 Development and regeneration
   04360 Axon guidance
    100171550 (NCK1)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100171550 (NCK1)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH2_2 hSH3
Other DBs
NCBI-GeneID: 100171550
NCBI-ProteinID: NP_001124702
Ensembl: ENSPPYG00000014133
UniProt: A0A2J8TTR9 Q5RF68
LinkDB
Position
3
AA seq 313 aa
MDWLNVFKDFFSIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDE
LSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVN
NLNTGQVLHVVQALYPFSSSNDEELNFEKGDIMDVIEKPENDPEWWKCRKINGMVGLVPK
NYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGD
FLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTS
EQGEKLYLVKHLS
NT seq 942 nt   +upstreamnt  +downstreamnt
atggattggttaaacgtctttaaagattttttcagcattggaaaagtgaaaagaaaacct
agtgtgccagattctgcatctcctgctgatgatagttttgttgacccaggggaacgtctc
tatgacctcaacatgcccgcttatgtgaaatttaactacatggctgagagagaggatgaa
ttatcattgataaaggggacaaaggtgatcgtcatggagaaatgcagtgatgggtggtgg
cgtggtagctacaatggacaagttggatggttcccttcaaactatgtaactgaagaaggt
gacagtcctttgggcgaccatgtgggttctctgtcagagaaattagcagcagtcgtcaat
aacctaaatactgggcaagtgttgcatgtggtacaggctctttacccattcagctcatct
aatgatgaagaacttaatttcgagaaaggagatataatggatgttattgaaaaacctgaa
aatgacccagagtggtggaaatgcaggaagatcaatggtatggttggtctagtaccaaaa
aactatgttactgttatgcagaataatccattaacctcaggtttggaaccatcacctcca
cagtgtgattacattaggccttcactcactggaaagtttgctggcaatccttggtattat
ggcaaagtcaccaggcatcaagcagaaatggcattaaatgaaagaggacatgaaggggat
ttcctcattcgtgatagtgaatcttcgccaaatgatttctcagtatcactaaaagcacaa
gggaaaaacaagcattttaaagtccaactaaaagagactgtctactgcattgggcagcgt
aaattcagcaccatggaagaacttgtagaacattacaaaaaggcacccatttttacaagt
gaacaaggagaaaaattatatcttgtcaagcatttatcatga

KEGG   Pongo abelii (Sumatran orangutan): 100452789
Entry
100452789         CDS       T01416                                 

Gene name
NCK2
Definition
(RefSeq) cytoplasmic protein NCK2 isoform X1
  KO
K19862  NCK adaptor protein 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04360  Axon guidance
pon04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100452789 (NCK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100452789 (NCK2)
  09158 Development and regeneration
   04360 Axon guidance
    100452789 (NCK2)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100452789 (NCK2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 100452789
NCBI-ProteinID: XP_009235096
Ensembl: ENSPPYG00000012125
UniProt: A0A6D2YAM0 A0A2J8S9G9
LinkDB
Position
2A
AA seq 380 aa
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFL
SLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgacagaagaagttattgtgatagccaagtgggactacaccgcccagcaggaccaggag
ctggacatcaagaagaacgagcggctgtggttgctggatgactccaagacgtggtggcgg
gtgaggaacgcggccaacaggacgggctatgtgccgtccaactacgtggagcggaagaac
agcctgaagaagggctccctcgtgaagaacctgaaggacacactaggcctcggcaagacg
cgcaggaagaccagcgcgcgggatgcgtcccccacgcccagcacggacgccgagtacccc
gccaatggcagcggcgccgaccgcatctacgacctcaacatcccggccttcgtcaagttc
gcctatgtggccgagcgggaggatgagttgtccctggtgaaggggtcgcgcgtcaccgtc
atggagaagtgcagcgacggttggtggcggggcagctacaacgggcagatcggctggttc
ccctccaactacgtcttggaggaggtggacgaggcagctgcagagtccccaagcttcctg
agcctgcgcaagggcgcctcgctgagcaatggccagggctcccgcgtgctgcatgtggtc
cagacgctgtaccccttcagctcagtcaccgaggaggagctcaacttcgagaagggggag
accatggaggtgatcgagaagcccgagaacgaccccgagtggtggaaatgcaaaaatgcc
cggggccaggtgggcctcgtccccaaaaactacgtggtggtcctcagtgacgggcctgcc
ctgcaccctgcgcacgccccacagataagctacaccgggccctcgtccagcgggcgcttc
gcgggcagagagtggtactacgggaacgtgacgcggcaccaggccgagtgcgccctcaac
gagcggggcgtggagggcgacttcctcattagggacagcgagtcctcgcccagcgacttc
tccgtgtcccttaaagcgtcagggaagaacaaacacttcaaggtgcagctcgtggacaat
gtctactgcattgggcagcggcgcttccacaccatggacgagctggtggaacactacaaa
aaggcgcccatcttcaccagcgagcacggggagaagctctacctcgtcagggccctgcag
tga

DBGET integrated database retrieval system