KEGG   Pongo abelii (Sumatran orangutan): 100171593
Entry
100171593         CDS       T01416                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1 precursor
  KO
K05132  interferon gamma receptor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04066  HIF-1 signaling pathway
pon04217  Necroptosis
pon04380  Osteoclast differentiation
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05200  Pathways in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100171593 (IFNGR1)
   04066 HIF-1 signaling pathway
    100171593 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100171593 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100171593 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100171593 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    100171593 (IFNGR1)
   04659 Th17 cell differentiation
    100171593 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100171593 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100171593 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100171593 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100171593 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100171593 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    100171593 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    100171593 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100171593 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100171593 (IFNGR1)
   05140 Leishmaniasis
    100171593 (IFNGR1)
   05142 Chagas disease
    100171593 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100171593 (IFNGR1)
   04090 CD molecules [BR:pon04090]
    100171593 (IFNGR1)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IFN receptor family
   100171593 (IFNGR1)
CD molecules [BR:pon04090]
 Proteins
  100171593 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100171593
NCBI-ProteinID: NP_001124744
Ensembl: ENSPPYG00000017039
UniProt: Q5RF03
LinkDB
Position
6
AA seq 489 aa
MALLFLLPLVMQGVSRAEMGTADLGPSSVPIPTNVTIESYNMNPIVYWEYQIMPQVPVFT
VEVKNYGVKNSEWIDACISISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSQEFA
VCRDGKIGPPKVDIRKEEKQIMIDVFHPSVFVNGDEQEVDYDPETTCYIKLYNVYVRMNG
SEIQYKILTQKEDDCDEIQCQLAIPASSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN
SSIKSSLWIPVVAALLLILVLSLVFICFYIKKINPLKEKSIILPKSLISVVRSATLETKP
ESKYVSLITSYQPSSLEKEVVCEGPLSPATVPGMHTEDNPGKVEHTEELSSITEVVTTEE
NIPDMAPGSHLTPVERESSSPLSSNQSEPCSIALNSYHSRNCSDSDHSRNGFDTDSSCLE
SHSSLSDSEFPPSNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYR
PTEDSKEFS
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggctctcctctttctcctaccccttgtcatgcagggtgtgagcagggctgagatgggc
accgcggatctggggccgtcctcagtgcctataccaactaatgttacaattgaatcctat
aacatgaaccctatcgtatattgggagtaccagatcatgccacaggtccctgtgtttacc
gtagaggtaaagaactatggtgttaagaattcagaatggattgatgcctgcatcagtatt
tctcatcattattgtaatatttctgatcacgttggtgatccatcaaattccctttgggtc
agagttaaagccagggttggacaaaaagaatctgcctatgcaaagtcacaagaatttgct
gtatgccgagatggaaaaattggaccacctaaagtggatatcagaaaagaggagaagcaa
atcatgattgacgtatttcacccttcggtttttgtaaatggagacgagcaggaagtcgat
tatgatcccgaaactacctgttacattaagctgtacaatgtgtatgtgagaatgaacgga
agtgagatccagtataaaatactcacgcagaaggaagatgattgtgacgagattcagtgc
cagttagcgattccagcgtcctcactgaattctcagtactgtgtttcagcagaaggagtc
ttacatgtatggggtgttacaactgaaaagtcaaaagaagtttgtattaccattttcaat
agcagcataaaaagttctctttggattccagttgttgctgctttactactcattctagtg
cttagcttggtattcatctgtttttatattaagaagattaatccattgaaggaaaaaagc
ataatattacccaagtccttgatctctgtggtaagaagtgctactttggagacgaaacct
gaatcaaaatatgtatcactcatcacgtcataccagccatcttccttagaaaaggaggtg
gtctgtgaagggccgttgtctccagcaacagttccaggcatgcataccgaagacaatcca
ggaaaagtggaacatacagaagaactttctagtataacagaagtggtgactactgaagaa
aatattcctgacatggccccgggcagccatctgactccagtagagagagagagttcttca
cctttaagtagtaaccagtctgaaccctgcagcatcgctttaaactcgtatcactccaga
aattgttctgatagtgatcactccagaaatggttttgatactgattccagctgtctggaa
tcacatagctccttatctgactcagaatttcccccaagtaataaaggtgaaataaaaaca
gaaggacaagagctcataacagtaataaaagcccccacctcctttggttatgataaacca
catgtgctagtggatctacttgtggatgatagcggtaaagagtccttgattggttataga
ccaacagaagattccaaagaattttcatga

KEGG   Pongo abelii (Sumatran orangutan): 100190822
Entry
100190822         CDS       T01416                                 

Gene name
IL11RA
Definition
(RefSeq) interleukin-11 receptor subunit alpha precursor
  KO
K05056  interleukin 11 receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100190822 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100190822 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100190822 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100190822 (IL11RA)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100190822 (IL11RA)
SSDB
Motif
Pfam: Ig_3 ig Ig_2 EpoR_lig-bind I-set
Other DBs
NCBI-GeneID: 100190822
NCBI-ProteinID: NP_001128982
Ensembl: ENSPPYG00000019115
UniProt: Q5RF19
LinkDB
Position
9
AA seq 422 aa
MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWF
RDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICRTLDGALGGTVTLQLGYPPARPVVSC
QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSTWSPEAWGTPSTGTVPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHR
DSVEQVAVLVSLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRHPGAP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgagcagggtcctggtggccgtggctacagccctggtg
tctgcctcctccccctgcccccaggcctggggccccccaggggtccagtatgggcagccc
ggcaggtctgtgaagctgtgttgtcctggagtgactgccggggacccagtgtcctggttt
cgggacggggagccaaagctgctccagggacctgactctgggctagggcatgaactggtc
ctggcccaggcagacagcactgatgagggcacctacatctgccggaccctggatggtgca
cttgggggcacagtgaccctgcagctgggctaccctccagcccgccctgttgtctcctgc
caagcagccgactatgagaacttctcttgcacttggagtcccagccagatcagcggttta
cccacccgctacctcacctcctacaggaagaagacagtcctaggagctgatagccagagg
aggagtccatccacagggccctggccatgcccacaggatcccctaggggctgcccgctgt
gttgtccacggggctgagttctggagccagtaccggattaatgtgactgaggtgaaccca
ctgggtgccagcacacgcctgctggatgtgagcttgcagagcatcttgcgccctgaccca
ccccagggcctgcgggtagagtcggtaccaggttacccccgacgcctgcgagccagctgg
acataccctgcctcctggccgcgccagccccacttcctgctcaagttccgtttgcagtac
cgtccggcgcagcatccagcctggtccacggtggagccagctggactggaggaggtgatc
acagatgctgtggctgggctgccccatgctgtacgagtcagtgcccgggactttctagat
gctggcacctggagcacctggagcccggaggcctggggaacccctagcactgggaccgta
ccaaaggagataccagcttggggccagctacacacgcagccagaggtggagcctcaggtg
gacagccctgctcctccaaggccttccctccaaccacatcctcggctacttgatcacagg
gactctgtggagcaggtagctgtgctggtgtctttgggaatcctttctttcctgggactg
gtggctggggccctggcactggggctctggctgaggctgagacggggcgggaaggatgga
tccccaaagcctgggttcttggcctcagtgattccagtggacaggcatccaggagctcca
aacctgtag

KEGG   Pongo abelii (Sumatran orangutan): 100294567
Entry
100294567         CDS       T01416                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor precursor
  KO
K05081  prolactin receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100294567 (PRLR)
   04151 PI3K-Akt signaling pathway
    100294567 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100294567 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    100294567 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100294567 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100294567 (PRLR)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  Prolactin receptor family
   100294567 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind GHBP
Other DBs
NCBI-GeneID: 100294567
NCBI-ProteinID: NP_001153263
Ensembl: ENSPPYG00000015393
UniProt: Q5RAW0
LinkDB
Position
5
AA seq 622 aa
MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWKPGTDGGLPTNY
SLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVD
VTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEW
EIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLL
SEKCEEPQTNPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQ
PSQHNPRSSYHNITDVCELAVGPAGAPATLLDEAGKDALKSSQTIKSGEEGKATQQREVE
SFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGQPKKPGTP
ENNKEQAKVSGVMDNNILVLVSDPHAKNMACFEESAKEGPPSLEQNQAEKALANFPATPS
KCRLQLGGLDYLDPACFTHSFH
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgaaggaaaatgtggcatctgcaactgttttcactctgctactttttctcaacacctgc
cttctgaatggacagttacctcccggaaaacctgagatctttaaatgtcgttctcccaat
aaggaaacattcacctgctggtggaagcctgggacagatggaggacttcctaccaattat
tcgctgacttaccacagggaaggagagacactcatgcatgaatgtccagactacataacc
ggtggccccaactcctgccactttggcaagcagtacacctccatgtggaggacatacatc
atgatggtcaatgccactaaccagatgggaagcagtttctcggatgagctttatgtggac
gtgacttacatagttcaaccagaccctcctttggagctggctgtggaagtaaaacagcca
gaagacagaaaaccctacctgtggattaaatggtctccacctaccctaattgacttaaaa
actggttggttcacgctcctgtatgaaattcgattaaagcctgagaaagcagctgagtgg
gagatccattttgctgggcagcaaacagagtttaagattctcagcctacatccaggacag
aaataccttgtccaggttcgctgcaaaccagaccatggatactggagtgcatggagtcca
gcgaccttcattcagatacctagtgacttcaccatgaatgatacaaccgtgtggatctct
gtggctgtcctttctgctgtcatctgtttgattattgtctgggcagtggctttgaagggc
tatagcatggtgacctgcatctttccgccagttcctgggccaaaaataaaaggatttgat
gctcatctgttggagaagggcaagtctgaagaactactgagtgccttgggatgccaagac
tttcctcccacttctgactatgaggacttgctggtggagtatttagaagtggatgatagt
gaggaccagcatctaatgtcagtccattcaaaagaacacccaagtcaaggtatgaaaccc
acatacctggatcctgacactgactcaggccgggggagctgtgacagtccttcccttttg
tctgaaaagtgtgaggaaccccagaccaatccctccacattctatgatcctgaggtcatt
gagaagccagagaatcctgaaacaacccacacctgggacccccagtgcataagcatggaa
ggcaaaatcccctattttcatgccggtggatccaaatgttcaacatggcccttaccacag
cccagccagcacaaccccagatcctcttaccacaatattactgatgtgtgtgagctggct
gtgggccctgcaggtgcaccggccaccctgttggacgaagcaggtaaagatgctttaaaa
tcatctcaaaccattaagtctggagaggagggaaaggcaacccagcagagggaggtagaa
agcttccattctgagactgaccaagatacgccctggctgctgccccaggagaaaaccccc
tttggctccgctaaacccttggattatgtggagattcacaaggtcaacaaagatggcgca
ttatcattgctaccaaaacagagagagaacagcggccagcccaagaagcccgggactcct
gagaacaataaggagcaagccaaggtgtctggggtcatggataacaacatcctggtgttg
gtgtcagatccacatgctaaaaacatggcttgctttgaagaatcagccaaagagggccca
ccatcacttgaacagaatcaagctgagaaagccctggccaacttccctgcgacaccaagc
aagtgcaggctccagctgggtggtttggattacctggatcccgcatgttttacacactcc
tttcattga

KEGG   Pongo abelii (Sumatran orangutan): 100431735
Entry
100431735         CDS       T01416                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100431735 (PDGFRA)
   04014 Ras signaling pathway
    100431735 (PDGFRA)
   04015 Rap1 signaling pathway
    100431735 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100431735 (PDGFRA)
   04020 Calcium signaling pathway
    100431735 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100431735 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100431735 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100431735 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100431735 (PDGFRA)
   04540 Gap junction
    100431735 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100431735 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431735 (PDGFRA)
   05206 MicroRNAs in cancer
    100431735 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100431735 (PDGFRA)
   05231 Choline metabolism in cancer
    100431735 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100431735 (PDGFRA)
   05218 Melanoma
    100431735 (PDGFRA)
   05215 Prostate cancer
    100431735 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100431735 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100431735 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100431735 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100431735 (PDGFRA)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100431735 (PDGFRA)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100431735 (PDGFRA)
CD molecules [BR:pon04090]
 Proteins
  100431735 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 100431735
NCBI-ProteinID: XP_009238298
Ensembl: ENSPPYG00000014767
UniProt: H2PDE4
LinkDB
Position
4
AA seq 1089 aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGENEVSWQYP
MSEEENSNVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDL
VDDHHGSTGGQMVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEVHPRD
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccggcgttcctggtcttaggctgtcttctcacagggctgagccta
atcctctgccagctttcattaccctctatccttccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagaatgaagtgagctggcagtacccc
atgtctgaagaagagaactccaatgtggaaatcagaaatgaagaaaacaacagtggcctt
tttgtgacggtcttggaagtgagcagtgcctcggcggcccacacagggttgtacacttgc
tattacaaccacactcagacagaagagaatgagcttgaaggcaggcacatttacatctat
gtgccagacccagatgtagcctttgtacctctaggaatgacggattatttagtcatcgtg
gaggatgatgattctgccatcataccttgtcgcacaactgatcccgagactcctgtaacc
ttacacaacagtgagggagtggtacctgcctcctacgacagcagacagggctttaatggg
accttcactgtagggccctatatctgtgaggccaccgtcaaaggaaagaagttccagacc
atcccatttaacgtttatgctttaaaagcaacatcagagctggatctagaaatggaagct
cttaaaaccgtgtataagtcaggggaaacgattgtggtcacctgtgctgtttttaacaat
gaggtggttgaccttcaatggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaagaaatcaaagtcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggctaccagggaggtcaaa
gaaatgaagaaagtcactatttctgtccatgagaaagggttcattgaaatcaaacccacc
ttcagccagttggaagctgtcaacctgcatgaagtcaaacattttgttgtagaggtgcgg
gcctacccacctcccaggatatcctggctgaaaaacaatctgactctgattgaaaatctc
actgagatcaccactgatgtggaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgtgctaaggaagaagacagtggccattatacaattgtagctcaaaatgaagat
gctgtgaagagctatacttttgaactgttaactcaagttccttcatcaattctggacttg
gtcgatgatcaccatggctcaactgggggacagatggtgagatgcacagctgaaggcacg
ccgcttcctgatattgagtggatgatatgcaaggatattaagaaatgtaataatgaaact
tcctggacgattttggccaacaatgtctcaaacatcatcacggaggtccacccccgagac
aggagtaccgtggagggccgtgtgactttcgccaaagtggaggagaccattgcggtgcga
tgcctggctaagaatctccttggagctgagaaccgagagctgaagctggtggctcccacc
ctgcgttctgaactcacggtggctgctgcagtcctggtgctgttggtgattgtgatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagcccggatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcaagatgggagtttccaagagatggactagtgcttggtcgggtcttgggg
tctggagcatttgggaaggtggttgaaggaacagcctatggattaagtcggtcccaacct
gtcatgaaagttgcagtgaagatgctaaaacccacggccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacatttgaacattgtaaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacggagtactgcttctatgga
gatttggtcaactatttgcataagaatagggatagcttcctgagccaccacccagagaag
ccaaagaaagagctggatatctttggattgaaccctgctgatgaaagcacacggagctat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgatactaca
cagtatgtccccatgctagaaagaaaagaggtttctaaatattccgacatccagagatca
ctctatgatcgtccagcctcatataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggccttactttattggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgtgatctggct
gctcgcaacgtcctcctggcacaaggaaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcaaactatgtgtcaaaaggcagtacctttctgcccgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagtgatgtctggtct
tacggcattctgctctgggagatcttttcccttggtggcaccccttaccccggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggctaagcctgaccat
gctaccagtgaagtctacgagatcatggtgaaatgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaaaattcacctggacttcctgaagagtgaccatcctgctgtggcacgcatg
cgtgtggactcagacaatgcgtacattggtgtcacctacaaaaacgaggaagacaagctg
aaggactgggagggtggtctggatgagcagagactgagcgctgacagtggctacatcatt
cctctgcctgacattgaccctgtccctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccattgagacgggttccagcagttccaccttcatc
aagagagaggacgagaccattgaagacatcgacatgatggacgacatcggcatagactct
tcagacctggtagaagacagcttcctgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100432479
Entry
100432479         CDS       T01416                                 

Gene name
IL27RA
Definition
(RefSeq) interleukin-27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100432479 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100432479 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100432479 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100432479 (IL27RA)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100432479 (IL27RA)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 100432479
NCBI-ProteinID: XP_024094121
LinkDB
Position
19
AA seq 635 aa
MRGGRGAPFWPWPLPKLALLPLLWVLFQRTRPQGSAGPLQCYGVGPLGDLNCSWEPLGDL
GAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFV
NLETQMKPNAPRLGPDVDFSEDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLE
PELKTIPLAPVEIQDLELATGYKVYGRCRMEKEEDLWGEWSPILSFQTPPSAPKDVWVSG
NLCGTPGGEELLLLWKAPGPCVQVSYKVWFWGGGRELSPEGITCCCSVIPSGAEWARVSA
VNATSWEPLTNLSLVCLDSASAPRSVAVSSIAGSTELLVTWRPGAGEPLEHVVDWARDGD
PLEKLNWVRLPPGNLSALLPGNFTVGVPYRITVTAVSASGLASAPSIWGFREELAPLVGP
TLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCAQSGTSPSVCMNVSGNTQSVTLPDL
PWGPCELWVTASTIAGQGPPGPILRLHLPDNTLRWKVLLGVLLWGLFLMGCGLSLATSGR
CYHLRHKVLPRWVWEKVPDPANSSSGQPHMEQVPEAQPLGDLPILEVEEMEPPPVMESSQ
PPQATAPLDSGYEKHFLPTPEELGLLGPPRPQVLA
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgcggggaggcaggggcgcccctttctggccgtggccgctgcccaagctggcgctgctg
cctctgttgtgggtgcttttccagcggacgcgtccccagggcagcgccgggccactgcag
tgctacggagttggacccttgggcgacttgaactgctcgtgggagcctcttggggacctg
ggagccccctccgagttacacctccagagccaaaagtaccgttccaacaaaacccagact
gtggcagtggcggctggacggagctgggtggccattcctcgggaacagctcaccatgtct
gacaaactccttgtctggggcaccaaggcaggccagcctctctggccccccgtcttcgtg
aacctagaaacccaaatgaagccaaacgccccccggctgggccctgacgtggacttttcg
gaggatgaccccctggaggccactgtccattgggccccacctacgtggccatctcataaa
gttctgatctgccagttccactaccgaagatgtcaggaggcagcctggaccctgctggaa
ccagagctgaagaccatacccctggcccctgttgagatccaagatttggagctagccact
ggctacaaagtgtatggccgctgccgaatggagaaagaagaggatttgtggggcgaatgg
agtcccattttgtccttccagacaccgccttctgctccaaaagatgtgtgggtatcaggg
aacctctgtgggacgcctggaggagaggaactcttgcttctatggaaggccccagggccc
tgtgtgcaggtgagctacaaagtctggttctggggtggaggtcgtgagctgagtccagaa
ggaattacctgctgctgctccgtaattcccagtggggcggagtgggccagggtgtccgct
gtcaacgccacaagctgggagcctctcaccaacctctctttggtctgcttggattcagcc
tctgccccccgtagtgtggcggtcagcagcatcgctgggagcacggagctactggtgacc
tggcgaccgggggctggggagccactggagcatgtagtggactgggctcgagatggggac
cccctggagaaactcaactgggtccggcttcccccagggaacctcagtgctctgttacca
gggaatttcactgtcggggtcccctatcgaatcactgtgaccgcagtctctgcttcaggc
ttggcctctgcaccctccatctgggggttcagggaggaactagcaccactagtggggcca
acgctttggcgactccaagatgcccctccaggaacccccgccatagcgtggggagaggtc
ccaaggcaccagcttcgaggccacctcacccactacaccttgtgtgcacagagtggaacc
agcccctccgtctgcatgaatgtgagtggcaacacacagagtgtcaccctgcctgacctt
ccttggggtccctgtgagctgtgggtgacagcatctaccatcgctggacagggccctcct
ggtcccatcctccggcttcatctaccagataacaccctgaggtggaaagttctgctgggc
gtcctattgtggggcttgttcctgatggggtgtggcctgagcctggccacttctggaagg
tgctaccacctaaggcacaaagtgctgccccgctgggtctgggagaaagttcctgatcct
gccaacagcagttcagggcagccccacatggagcaagtgcctgaggcccagccccttggg
gacttgcccatcctggaagtggaggagatggagcccccgccggttatggagtcctcccag
cccccccaggccaccgccccgcttgattctgggtatgagaagcacttcctgcccacacct
gaggagctgggccttctggggccccccaggccacaggttctggcctga

KEGG   Pongo abelii (Sumatran orangutan): 100433338
Entry
100433338         CDS       T01416                                 

Gene name
CSF3R
Definition
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100433338 (CSF3R)
   04151 PI3K-Akt signaling pathway
    100433338 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100433338 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100433338 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100433338 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100433338 (CSF3R)
   04090 CD molecules [BR:pon04090]
    100433338 (CSF3R)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  Prolactin receptor family
   100433338 (CSF3R)
CD molecules [BR:pon04090]
 Proteins
  100433338 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind fn3_2 IL6Ra-bind ObR_Ig
Other DBs
NCBI-GeneID: 100433338
NCBI-ProteinID: XP_024093579
LinkDB
Position
1
AA seq 836 aa
MARLGTCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQ
ILWRLGAELQPGGRQQRLSDGTQESIITLPHLNYTQAFLSCCLNWGNSLQILDQVELRAG
YPPAVPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPK
DGQSHCSIPRRHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDVVKLEPPMLRTMDPSPE
AAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQHGEASWALVGPLPLEALRYELCGLLPA
TAYTLQIRCIRWPLPGHWSDWSPSLELRTTERAPTVRLDTWWRQRQLDPRTVQLFWKPVP
LEEDSGQIQGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPT
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPSPWPQGYVIEWGLGPPSASNSNKTWRME
QNGSATGFLLKENIRPFQLYEITVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGK
TWVQLEWVPEPPELGKSPLTHYTIFWTNVQNQSFSAILNASSRGFVLHGLEPASLYHIHL
MAASQAGATNSTVLTLMTLTPEGSELHILLGLFGLLLLLTCLCGTAWLCCSPNRKNPLWP
SVPDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLEEDKKKPVPWESHNSSETCGL
PTLVQTYVLQGDPRAASTQPQSQSGTSDQVLYGQLLGSPTSPGPGHYLRCDSTQPLLAGL
TPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLDFPLLQGIRVHGMEGLGSF
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggcaaggctgggaacctgcagcctgacttgggctgccctgatcatcctgctgctcccc
ggaagtctggaggagtgcgggcacatcagtgtctcagcccccatcgtccacctgggggat
cccatcacagcctcctgcatcatcaagcagaactgcagccatctggacccggagccacag
attctgtggagactgggagcagagcttcagcccgggggcaggcagcagcgtctgtctgat
gggacccaggaatctatcatcaccctgccccacctcaactacactcaggcctttctctcc
tgctgcctgaactggggcaacagcctgcagatcctggaccaggttgagctgcgcgcaggc
taccctccagccgtaccccacaacctctcctgcctcatgaacctcacaaccagcagcctt
atctgccagtgggagccaggacctgagacccacctacccaccagcttcactctgaagagc
ttcaagagccggggcaactgtcagacccaaggggactccatcctggactgcgtgcccaag
gacgggcagagccactgctccattccacgcagacacctgctgttgtaccagaatatgggc
atctgggtgcaggcggagaacgcgctggggaccagcatgtccccacaactgtgtcttgat
cccatggacgttgtgaaactggagccccccatgctgcgcaccatggaccccagccctgaa
gcggcccctccccaggcaggctgcctacagctgtgctgggagccatggcagccaggcctg
cacataaatcagaagtgtgagctgcgccacaagccgcagcatggagaagctagctgggca
ctggtgggccccctgcccttggaggcccttcgatatgagctctgcgggctcctcccagcc
acggcctacaccctgcagatacgctgcatccgctggcccctgcctggccactggagcgac
tggagccccagcctggagctgagaactaccgaacgggcccccactgtgagactggacaca
tggtggcggcagaggcagctggaccccaggacagtgcagctgttctggaagccagtgccc
ctggaggaagacagcggacagatccaaggttatgtggtttcttggagaccctcaggccag
gctggggccatcctgcccctctgcaacaccacagagctcagctgcaccttccacctgcct
tcagaagcccaggaggtggcccttgtggcctataactcagccgggacctctcgtcccacc
ccggtggtcttctcagaaagcagaggcccagccctgaccagactccatgccatggcccga
gaccctcacagcctctgggtaggctgggagccccccagtccatggcctcagggctatgtg
attgagtggggcctgggcccccccagcgcgagcaatagcaacaagacctggaggatggaa
cagaatgggagcgccacggggtttctgctgaaggagaacatcaggccctttcagctctat
gagatcactgtgactcctttgtaccaggacaccatgggaccctcccagcatgtctatgcc
tactcccaagaaatggctccctcccatgccccagagctgcatctaaagcacattggcaag
acctgggtacagctggagtgggtgcctgagccccctgagctggggaagagcccccttacc
cactacaccatcttctggaccaacgttcagaaccagtccttctccgccatcctgaatgcc
tcctcccgtggctttgtcctccatggcctggagcccgccagtctgtatcacatccacctc
atggctgccagccaggccggggccaccaacagtacagtcctcaccctgatgaccttgact
ccagaggggtcggagctacacatcctcctgggcctgttcggcctcctgctcttgctcacc
tgcctctgtggaactgcctggctctgctgcagccccaacaggaagaatcccctctggcca
agtgtcccagacccagctcacagcagcctggggtcctgggtgcccacaatcatggaggag
gatgccttccagctgcccggccttggcacgccacccatcaccaagctcacagtgctggag
gaggacaagaagaagccggtgccctgggaatcccataacagctcagagacctgtggcctc
cccactctggtccaaacctatgtgctccagggggacccaagagcagcttccacccagccc
caatcccagtctggcaccagcgatcaggtcctttatgggcagctgctgggcagccccaca
agcccagggccagggcactatctccgctgtgactccactcagcccctcttggcgggcctc
acccccagccccaagtcctatgagaacctctggttccaggccagccccctggggaccctg
gtaaccccagccccaagccaggaggacgactgtgtctttgggccactgctcgacttcccc
ctcctgcaggggatccgggtgcatgggatggaggggctggggagcttctag

KEGG   Pongo abelii (Sumatran orangutan): 100435478
Entry
100435478         CDS       T01416                                 

Gene name
IL12RB1
Definition
(RefSeq) interleukin-12 receptor subunit beta-1 isoform X1
  KO
K05063  interleukin 12 receptor beta-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon05200  Pathways in cancer
pon05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100435478 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100435478 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100435478 (IL12RB1)
   04659 Th17 cell differentiation
    100435478 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100435478 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100435478 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100435478 (IL12RB1)
   04090 CD molecules [BR:pon04090]
    100435478 (IL12RB1)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100435478 (IL12RB1)
CD molecules [BR:pon04090]
 Proteins
  100435478 (IL12RB1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 100435478
NCBI-ProteinID: XP_024093007
LinkDB
Position
19
AA seq 662 aa
MGPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLSCYRISSDHY
ECSWQYEGPTAGVNHFLRCCLSSGRCCYFATGSATRLQFSDQAGVSVLYTVTLWVESWAR
NQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPTSP
WKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGRQGSSWSKWSSPVCVPPENPPQPQ
VRFSVEQLGRDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRT
LHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPA
RPQSTTYCIEWQPVGQDGGLATCNLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFA
SAHPKKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKE
YVVRCRDEDSNQVSEYPVQPTETQVTLSGLRAGVAYTVQVRADTAWLMGVWSQPQRFSIE
VQVSDWLIFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQ
WINPVDFQEEASLQEALVVEMSWDKGERTEPLKKTELPEGASELALDTELSLEDGDRCKA
KM
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggggccgctggtgacctgggtggtccccctcctcttcctcttcctgctgtccaggcag
ggtgctgcctgcagaaccagtgagtgctgttttcaggacccgccatatccggatgcagac
tcaggctcggcctcgggtcctagggacctgagctgctatcggatatccagtgatcattac
gagtgctcctggcagtatgaaggtcccacagctggggtcaaccacttcctgcgatgttgc
cttagctccgggcgctgctgctacttcgccactggctcagccaccaggctgcagttctcc
gaccaggctggggtgtctgtgctgtacaccgtcacactctgggtggaatcctgggccagg
aaccagacagagaagtctcctgaggtgaccctgcagctctacaactcagttaaatatgag
cctcctctgggagacatcaaggtgtccaagttggccgggcagctgcgaatggagtgggag
accccggataaccaggttggtgctgaggtgcagttccgtcaccggacacccaccagccca
tggaagttgggcgactgcggacctcaggatgatgatactgagtcctgcctctgccccctg
gagatgaatgtggcccaggaattccagctccgacgacggcggctggggagacaaggaagt
tcctggagcaagtggagcagccccgtgtgcgttccccctgaaaaccccccacagcctcag
gtgagattctcggtggagcagctgggccgagatgggaggaggcggctgaccctgaaagag
cagccaacccagctggagcttccagaaggctgtcaagggctggcgcctggcacagaggtc
acctaccgactgcagctccacatgctgtcctgcccgtgtaaggccaaggccaccaggacc
ctgcacctggggaagatgccctatctctcgggtgctgcctacaacgtggctgtcatctcc
tcgaaccaatttggtcctggcctgaaccagacgtggcacattcctgccgacacccacaca
gaaccagtggctctgaatatcagcgtcggaaccaacgggaccaccatgtattggccagcc
cggcctcagagcacgacgtattgcattgaatggcagcccgtgggccaggacgggggcctt
gccacctgcaacctgactgcgccgcaagacccggatccggctggaatggcaacatacagc
tggagtcgagagtctggggcaatggggcaggaaaagtgttactacattaccatcttcgcc
tctgcgcaccccaagaagctcaccttgtggtctacagtcctgtccacctaccactttggg
ggcaatgcctcagcggctgggacaccacaccacgtctcggtgaagaatcatagcttggac
tctgtgtctgtggactgggcaccatccctgctgagcacctgtcccggcgtcctaaaggag
tatgttgtccgctgccgagatgaagacagcaaccaggtgtcagagtatcccgtgcagccc
acagagacccaagttaccctcagtggcctgcgggctggtgtagcctacacggtgcaggtg
cgagcagacacagcgtggctgatgggtgtctggagccagccccagcgcttcagcatcgaa
gtgcaggtttctgattggctcatcttcttcgcctccctggggagcttcctgagcatcctt
ctcgtgggcgtccttggctaccttggcctgaacagggccgcacggcacctgtgtccgccg
ctgcccacaccctgtgccagctccgccattgagttccctggagggaaggagacttggcag
tggatcaacccagtggacttccaggaagaggcatccctgcaggaggccctggtggtggag
atgtcctgggacaaaggcgagaggactgagcctctcaagaagacagagctacctgagggt
gcctctgagctggccctggatacagagttgtccttggaggatggagacaggtgcaaggcc
aagatgtga

KEGG   Pongo abelii (Sumatran orangutan): 100436549
Entry
100436549         CDS       T01416                                 

Gene name
IL10RA
Definition
(RefSeq) interleukin-10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04630  JAK-STAT signaling pathway
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100436549 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100436549 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100436549 (IL10RA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100436549 (IL10RA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100436549 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100436549 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100436549 (IL10RA)
   04090 CD molecules [BR:pon04090]
    100436549 (IL10RA)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL10/28 receptor family
   100436549 (IL10RA)
CD molecules [BR:pon04090]
 Proteins
  100436549 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100436549
NCBI-ProteinID: XP_002822583
Ensembl: ENSPPYG00000003920
UniProt: H2NFF7 A0A6D2WFI4
LinkDB
Position
11
AA seq 578 aa
MLPCLVVLLAALLSLRLGSDAHETELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVA
LLRYGIEPWNSISNCSQALSYDLTTVTLDLYRSSGYRARVRAVDGSRHSNWTVTNTRFSV
DEVTLTVGSVKLEIHNGFILGEIQPPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTF
THKKVKHENFSLLTSGEVGEFCVQVKPSVASRTNKGMWSKEECVSLTRQYFTVTNVIIFF
AFVLLLSGVLAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEA
FLKVSPELRNSDLHGSTDSGFGSTKPSLQTEEPQFLLPAPPPQADRTLENGELPVLGDSC
SGGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIGLVQNSKGRAGDTQRGS
ALGHHSPPEPEVPGEEDPAAVAFLGYLRQTRYAEEKATKTGCLEEESPLTDGLGPKFGRC
LDDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGTSDWS
FAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgctgccgtgcctcgtagtgctgctggcggcgctcctcagcctccgtcttggctcagac
gctcatgagacagagctgcccagccctccgtctgtgtggtttgaagcagaatttttccac
cacatcctccactggacacccatcccaaatcaatctgaaagtacctgctatgaagtggcg
ctcctgaggtatggaatagagccctggaactccatctccaactgtagccaggccctgtcc
tacgaccttaccacagtgaccctggacctgtaccgcagcagtggctaccgggccagagtc
cgggctgtggacggcagccggcactccaactggaccgtcaccaacacccgcttctctgtg
gatgaagtgactctgacagttggcagtgtgaagctagagatccacaatggcttcatcctc
ggggagattcagccccccaggcccaagatggcccctgcaaatgacacatatgaaagcatc
ttcagtcacttccgagagtatgagattgccattcgcaaggtgccaggaaacttcacgttc
acacacaagaaagtaaaacatgaaaacttcagcctcctaacctctggagaagtgggagag
ttctgtgtccaggtgaaaccatctgtcgcttcccgaactaacaaggggatgtggtctaaa
gaggagtgcgtctccctcaccaggcagtatttcaccgtgaccaacgtcatcatcttcttt
gcctttgtcctgctgctctccggagtcctcgcctactgcctggccctccagctgtatgtg
cggcgccgaaagaagctgcccagtgtcctgctcttcaagaagcccagccccttcatcttc
atcagccagcgtccctccccagagacccaagacaccatccacccgcttgatgaggaggcc
ttcctgaaggtgtccccagagctgaggaactcggacctgcacggcagcacggacagtggc
tttggcagcacaaagccatccctgcagactgaagagccccagttcctcctccctgcccct
cccccccaggctgacagaacgctggaaaacggggagctccctgtgctgggggacagctgc
agtggtggcagcagcaatagcacagacagcgggatctgcctgcaggagcccagcctgagc
cccagcacagggcccacctgggagcagcaggtggggagcaacagcaggggccaggatgac
agtggcattggcctagttcaaaactctaagggccgggctggggacacacagcgtggctca
gccttgggccaccacagtcccccagagcctgaggtgcctggggaagaagacccagctgct
gtggcattcctgggctacctgaggcagaccagatacgctgaagagaaggcaaccaagaca
ggctgcctggaggaagaatcgcccttgacagatggccttggccccaaattcgggagatgc
ctggatgatgaggcaggcttgcatccaccagccctggccaagggctatttgaaacaggat
cctctagaaatgactctggcttcctcaggggccccaactggacagtggaaccagcccact
gaggaatggtcactcctggccttgagcagctgcagtgacctgggaacatctgactggagc
tttgcccatgaccttgcccctctaggctgtgtggcagccccaggtggtctcctgggcagc
tttaactcagacctggtcaccctgcccctcatctctagcctgcagtcaagtgagtga

KEGG   Pongo abelii (Sumatran orangutan): 100439247
Entry
100439247         CDS       T01416                                 

Gene name
IL15RA
Definition
(RefSeq) interleukin-15 receptor subunit alpha isoform X6
  KO
K05074  interleukin 15 receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04672  Intestinal immune network for IgA production
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100439247 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100439247 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100439247 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100439247 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100439247 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100439247 (IL15RA)
   04090 CD molecules [BR:pon04090]
    100439247 (IL15RA)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100439247 (IL15RA)
CD molecules [BR:pon04090]
 Proteins
  100439247 (IL15RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 100439247
NCBI-ProteinID: XP_002820540
Ensembl: ENSPPYG00000002065
LinkDB
Position
10
AA seq 271 aa
MRLAGRQVPEPRSPPPPGPGLGSARPGRPTVPCGAAAMAPQRAHGCRTLGLPALLLLLLL
RPPATRGITCPPPMSVEHADIWVKSYSLYSRERYVCNSGFKRKAGTSSLTECVLNKATNV
AHWTTPSLKCIKPAASSPSSNTTAATTAAIVPGSRLTPSKSPSTGTTEIGSHESSHGTPS
QTTAKTWELTASASHQPPGVYPQGHSDTAVAISTSTVLLCGLSAVSLLACYIKSRQTPPL
ASVEMEAMEALPVTGGTSSRDEDLENCSHHL
NT seq 816 nt   +upstreamnt  +downstreamnt
atgcgactggcggggcggcaggtcccagagccgcgctcgccacctccccctggccccggc
ctgggcagcgctcgcccggggcgtccaacggtgccctgtggagctgcggccatggccccg
cagcgggcgcacggctgccggaccctcggtctcccggcgctgctgctgctgctgctgctc
cggccgccggcgacgcgtggcatcacgtgccctccccccatgtccgtggaacatgcagac
atctgggtcaagagctacagcttgtactccagggagcggtacgtttgtaactctggtttc
aagcgtaaagccggcacgtccagcctgacggaatgtgtgttgaacaaggccaccaacgtc
gcccactggacaacccccagtctcaaatgcattaagcccgcagcttcatctcccagctca
aacaccacagcggccacaacagcagctattgtcccgggctcccggctgacgccttcaaaa
tcaccttccacaggaaccacagagataggcagtcatgagtcctcccacggcaccccctct
cagacaacagccaagacctgggaactcacagcatccgcctcccaccagccgccaggtgtg
tatccacagggccacagcgacactgctgtggctatctccacgtccaccgtcctgctgtgt
ggtctgagcgctgtgtctctcctggcatgctacatcaagtcaaggcaaactcccccgctg
gccagcgttgaaatggaagccatggaggctctgccggtgactggggggaccagcagcaga
gatgaagacttggaaaactgctctcaccacctatga

KEGG   Pongo abelii (Sumatran orangutan): 100439694
Entry
100439694         CDS       T01416                                 

Gene name
LIFR
Definition
(RefSeq) leukemia inhibitory factor receptor
  KO
K05058  leukemia inhibitory factor receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100439694 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100439694 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100439694 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100439694 (LIFR)
   04090 CD molecules [BR:pon04090]
    100439694 (LIFR)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100439694 (LIFR)
CD molecules [BR:pon04090]
 Proteins
  100439694 (LIFR)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 EpoR_lig-bind Pur_ac_phosph_N IL6Ra-bind TMEM154 DUF3827
Other DBs
NCBI-GeneID: 100439694
NCBI-ProteinID: XP_002815555
Ensembl: ENSPPYG00000015411
UniProt: H2PFD9
LinkDB
Position
5
AA seq 1097 aa
MMDIYVCLKRPSSMVDNKRMRTASNFQWLLSTFILLYLMNQVNSQKKGAPHDLKCVTNNL
QVWDCSWKAPSGTGRGTDYEVCIENRSHSCYQLEKTSIKIPALSHGDYEITIHSLHDFGS
STSKFTLNEQNVSLIPDTPEILNLSADFSTSTLYLKWNDRGSVFPHRSNVIWEIKVLRKE
SMALVKLVTHNTTLSGKDTLHHWSWASDMPLECAIHFVEIRCYIDNLHFSGRKEWSDWSP
VKNISWIPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSALIGHTNCPLIHLDGENVAIK
IRNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETHDLKEIICSWNPGRATA
LVGPRATSYTLVESFSGKYVRLKRAEAPTNESYQLLFQMLPNQEIYNFTLNAHNPLGRSQ
STILVNITEKVYPHTPTSFKVKDINSTAVKLSWHLPGNFAKINFLCQIEIKKSNSVQEQR
NVTIKGVENSSYLVALDKLNPYTLYTFRIRCSTETFWKWSKWSNKKQHLTTEAIPSKGPD
TWREWSSDGKNLIIYWKPLPINEANGKILSYNVSCSSDEETQSLSEIPDPQHKAEIRLDK
SDYIISVVAKNSVGSSPPSKIASMEIPNDDLKIEQVVGMGKGILLTWHYDPNVTCDYVIK
WCNSSRSEPCLMDWRKVPSNSTETVIESDQFRPGVRYHFFLYGCRNQGYQLLRSMIGYIE
ELAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFGKGERDTSKMRVLESGR
SDIKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGVGPEKSMYVVTKENSVGLIIAI
LIPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLEM
NPCTPNNVEVLETRSAFPKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPIIEEEIPN
PAADEAGGTAQVIYIDVQSMYQPQAKPEEEQENDPVGGAGYKPQMHLPINSTVEDITAEE
DLDKTAGYRPQANVNTWNLVSPDSPRSIDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKS
NGGGWSFTNFFQNKPND
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgatggatatttatgtatgtttgaaacgaccatcctcaatggtggacaataaaagaatg
aggactgcttcaaatttccagtggctgttatcaacatttattcttctatatctaatgaat
caagtaaatagccagaaaaagggggctcctcatgatttgaagtgtgtaactaacaatttg
caagtgtgggactgttcttggaaagcaccctctggaacaggccgtggtactgattatgaa
gtttgcattgaaaacaggtcccattcttgttatcagttggagaaaaccagtattaaaatt
ccagctctttcacatggtgattatgaaataacaatacattctctacatgattttggaagt
tctacaagtaaattcacactaaatgaacaaaacgtttccttaattccagatactccagag
atcttgaatttgtctgctgatttctcaacctctacattatacctaaagtggaacgacagg
ggttcagtttttccacaccgctcaaatgttatctgggaaattaaagttctacgtaaagag
agtatggcgctcgtaaaattagtgacccacaacacaactctgagtggcaaagatacactt
catcactggagttgggcctcagatatgcccttggagtgtgccattcattttgtggaaatt
agatgctacattgacaatcttcatttttctggtcgcaaagagtggagtgactggagccct
gtgaagaacatttcttggatacctgattctcagactaaggtttttcctcaagataaagtg
atacttgtaggctcagacataacgttttgttgtgtgagtcaagaaaaagtgttatcagca
ctgattggccatacaaactgccccttgatccatcttgatggggaaaatgttgcaatcaag
attcgtaatatttctgtttctgcaagtagtggaacaaatgtagtttttacaaccgaagat
aacatatttggaacggttatttttgctggatatccaccagatactcctcaacaactgaat
tgtgagacacatgatttaaaagaaattatatgtagttggaatccaggaagggcgacagca
ttggtgggcccacgtgctacaagctacactttagttgaaagtttttcaggaaaatatgtt
agacttaaaagagctgaagcacctacaaatgaaagctatcaattattatttcaaatgctt
ccaaatcaagaaatatataattttactttgaatgctcacaatcctctgggtcgatcacaa
tcaacaattttagttaatataactgaaaaagtttatcctcatactcctacttcattcaaa
gtgaaggacattaattcaacagctgttaaactttcttggcatttaccaggcaactttgca
aagattaattttttatgtcaaattgaaattaagaaatctaattcagtacaagaacagcgg
aatgtcacaatcaaaggagtagaaaactcaagttatcttgttgctctggacaagttaaat
ccatacactctgtatacttttcggattcgttgttctactgaaactttctggaaatggagc
aaatggagcaataaaaaacaacacttaaccacagaagccattccttcaaaggggcctgat
acttggagagagtggagttctgatggaaaaaatttaataatctattggaagcctttaccc
attaatgaagctaatggaaaaatactttcctacaatgtatcatgttcatcagatgaggaa
acacagtccctttctgaaatccctgatcctcagcacaaagcagagatacgacttgataag
agtgactacatcatcagcgtggtggctaaaaattctgtgggctcatcaccaccttccaaa
atagcgagcatggaaattccaaatgatgatctcaaaatagaacaagttgttgggatggga
aaggggattctcctcacctggcattacgaccccaacgtgacttgcgactacgtcattaag
tggtgtaactcgtctcggtcggaaccatgccttatggactggagaaaagttccctcaaac
agcactgaaactgtaatagaatctgatcagtttcgaccaggtgtaagataccattttttc
ctgtatggatgcagaaatcaaggatatcaattattacgctccatgattggatatatagaa
gaattggctcccattgttgcaccaaattttactgttgaggatacttctgcagattcaata
ttagtaaaatgggaagacattcctgtggaagaacttagaggctttttaagaggatatttg
ttttactttggaaaaggagaaagagacacatctaagatgagggttttagaatcaggtcgt
tctgacataaaggttaagaatattactgacatatcccagaagacactgagaattgctgat
cttcaaggtaaaacaagttaccacctggtcttgcgagcctatacagatggtggagtgggc
ccagagaagagtatgtacgtggtgacaaaggaaaattctgtgggattaattattgccatt
ctcatcccagtggcagtggctgtcattgttggagtggtgacaagtatcctttgctatcgg
aaacgagaatggattaaagaaaccttctaccctgatattccaaatccagaaaactgtaaa
gcgttacagtttcagaagagtgtctgtgagggaagcagtgctcttaaaacattggaaatg
aatccttgtaccccaaataatgttgaggttctggaaactcgatcagcatttcctaaaata
gaagatacagaaataatttccccagtagctgagcgtcctgaagatcgctctgatgcagag
cctgaaaaccatgtggttgtgtcctattgtccacccatcattgaggaagaaataccaaac
ccagccgcagatgaagctggagggactgcacaggtcatttacattgatgttcagtcgatg
tatcagcctcaagcaaaaccagaagaagaacaagaaaatgaccctgtaggaggggcaggc
tataagccacagatgcacctccccattaattctactgtggaagatataactgcagaagag
gacttagataaaactgcgggttacagacctcaggccaatgtaaatacatggaatttagtg
tctccagactctcctagatccatagacagcaacagtgagattgtctcatttggaagtccg
tgctccattaattcccgacaatttttgattcctcctaaagatgaagactctcctaaatct
aatggaggagggtggtcctttacaaacttttttcagaacaaaccaaacgattaa

KEGG   Pongo abelii (Sumatran orangutan): 100440118
Entry
100440118         CDS       T01416                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha isoform X1
  KO
K05068  interleukin 2 receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100440118 (IL2RA)
   04151 PI3K-Akt signaling pathway
    100440118 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100440118 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100440118 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100440118 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100440118 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    100440118 (IL2RA)
   04659 Th17 cell differentiation
    100440118 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440118 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100440118 (IL2RA)
   05162 Measles
    100440118 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100440118 (IL2RA)
   04090 CD molecules [BR:pon04090]
    100440118 (IL2RA)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100440118 (IL2RA)
CD molecules [BR:pon04090]
 Proteins
  100440118 (IL2RA)
SSDB
Motif
Pfam: Sushi TMEM100 Stevor
Other DBs
NCBI-GeneID: 100440118
NCBI-ProteinID: XP_002820543
Ensembl: ENSPPYG00000002066
UniProt: A0A663DFI2 H2N9P4
LinkDB
Position
10
AA seq 272 aa
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEVAHATFKAVVYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSAARNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTSETETSQFPGEEKPQASPEGHPESETSCLVTTADFQIQTEMASTMETFIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRRRKSRRTI
NT seq 819 nt   +upstreamnt  +downstreamnt
atggattcatacctgctgatgtggggactgctcacgttcatcatggtgcctggctgccag
gcagagctctgtgacgatgacccaccagaggtcgcacatgccaccttcaaagctgtggtc
tacaaggaaggaaccatgttgaactgtgagtgcaagagaggtttccgcagaataaaaagc
gggtcactctatatgctctgtacaggaaactctagccactcatcctgggacaaccaatgt
caatgcacaagctctgccgctcggaacacaacaaaacaagtgacacctcaacctgaagaa
cagaaagaaagaaaaaccacagaaatgcaaagtccaatgcagccggtggaccaagcgagc
cttccaggtcactgcagggaacctccaccgtgggaaaatgaagccacagagagaatttat
cattttgtggtggggcagatggtttactaccagtgcgtccagggatacagggctctacac
agaggtcctgctgagagcgtctgcaaaatgacccatgggaagacaaggtggacccagccc
cagctcatatgcacaagtgaaacggagaccagtcagtttccaggtgaagagaagcctcag
gcaagccccgaaggccatcctgagagtgagacttcctgcctcgtcacaacagcagatttt
caaatacagacagaaatggcttcaaccatggagacgttcatatttacaacagagtaccag
gtagcagtggccggctgtgttttcctgctgatcagcgtcctcctcctgagtgggcttacc
tggcagcggagacggaggaagagtagaagaactatctag

KEGG   Pongo abelii (Sumatran orangutan): 100440306
Entry
100440306         CDS       T01416                                 

Gene name
OSMR
Definition
(RefSeq) oncostatin-M-specific receptor subunit beta
  KO
K05057  oncostatin M receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100440306 (OSMR)
   04151 PI3K-Akt signaling pathway
    100440306 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100440306 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100440306 (OSMR)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100440306 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 100440306
NCBI-ProteinID: XP_024102699
Ensembl: ENSPPYG00000015413
LinkDB
Position
5
AA seq 980 aa
MALFAVFPTTFFLTLLSLRTYQSEVSAERLPLTPVSLKVSTNSTHQSLHLQWTVHNLPYH
QELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSVVDD
AKFPEPNFWSNWSSWEEVSVQDSFGQDILFVFPKDKLVEEGSNVTICYVSRNIQNNVSCY
LEGKQIHGEQLDPHVTSFNLSSVPFIRNKGTNIYCEASQGNVSKGIKGIVLFVSKVLEEP
KNFSCETQDFKTLHCTWDPGTDTALGWFKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQ
DSEETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSMRN
NFTYLCQIELHGEGKMMQQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWS
GQNFTTLEAAPSEAPDVWRIVNLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPS
RSELHSIPAPANSTKLILDRCSYQICVTANNSVGASPASVIVISADPESKDVEEERIAGT
EGGFSLSWKPQPGDVIGYVVDWCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDF
RIYGLSTKRIACLLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQG
YHVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFVTPFTS
AGEGPNATFTKVTTPDEHSAMLIHILLPMVFCVLLIMVMCYLKSQWIKETCYPDIPDPYK
SSILSLIKFKENPHLTIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLY
LLPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVPPKAPSMLGLMTSPENVLKALEK
NYMNSLGEIPAGETSLNYVSQLASPMFGDKDSLPTNPVEPPHCSEYKMQMAVPLRLALPP
PTENSSLSSITLLDPGEHYR
NT seq 2943 nt   +upstreamnt  +downstreamnt
atggctctatttgcagtctttccgacaacattcttcttaacattgctgtccttgaggact
taccagagtgaagtctcggctgaacgtttaccattgactcctgtatcacttaaagtttcc
accaattctacacatcagagtttgcatttacaatggactgtccacaaccttccttatcat
caggaattgaaaatggtgtttcagatccagatcagtaggattgaaacatccaatgtcatc
tgggtggggaattacagcaccactgtgaagtggaaccaggttctgcattggagctgggaa
tccgagctccctttggaatgtgccacacactttgtaagaataaagagtgtggtggacgat
gccaagttccctgagccaaatttctggagcaactggagttcctgggaggaagtcagtgta
caagattcttttggacaggatatattgttcgttttccctaaagataagctggtggaagaa
ggctccaatgttaccatttgttacgtttctaggaacattcaaaataatgtatcctgttat
ttggaagggaaacagattcatggagaacaacttgatccacatgtaacttcattcaacttg
agtagtgtgcctttcattaggaataaagggacaaatatctattgtgaggcaagtcaagga
aatgtcagtaaaggcataaaaggcatcgttctttttgtctcaaaagtacttgaggagccc
aagaacttttcttgtgaaacccaggacttcaagactttgcactgtacttgggatcctggg
acagacactgccttggggtggtttaaacaaccttcccaaagctacactttatttgaatca
ttttctggggaaaagaaactttgtacacacaaaaactggtgtaattggcaaataactcaa
gactcagaagaaacttataacttcacactcatagctgaaaattacttaaggaagagaagt
gtcaatatcctttttaacctgactcatcgagtttatttaatgaatccttttagtgtcaac
tttgaaaatgtaaatgccacaaatgccatcatgacctggaaggtgcattccatgaggaat
aatttcacatatttgtgtcagattgaactccatggtgaaggaaaaatgatgcaacagtac
aatgtttccatcaaggtgaacggtgagtacttcttaagtgaactggaacctgccacagag
tacatggcgcgagtacgctgtgctgatgccagccacttctggaaatggagtgaatggagt
ggtcaaaacttcaccacacttgaagctgctccctcagaggcccctgatgtctggagaatt
gtgaacttggagccaggaaatcatactgtgaccttattctggaagccattatcaaaactg
catgccaatggaaagatcctgttctataatgtagttgtagaaaacctagacaaaccatcc
aggtcagagctccattccattccggcaccggccaacagcacaaaactaatcctcgacagg
tgttcctaccaaatctgtgtcacagccaacaacagtgtgggtgcttctcctgcttctgta
atagtcatctctgcagaccctgaaagcaaagatgttgaggaagaaagaattgcaggcaca
gagggtggattctctctgtcttggaaaccccaacctggagatgttataggctatgttgtg
gactggtgtgaccatacccaggatgtgctcggtgatttccagtggaagaatgtaggtccc
aatactacaagcacagtcattagcacagatgcttttaggccaggagttcgatacgacttc
agaatttatgggttatctacaaaaaggattgcttgtttattagagaaaaaaacaggatac
tctcaggaacttgctccttcagacaaccctcacgtgctggtggatacgttgacatcccac
tccttcactctgagttggaaagattactctactgaatctcaacctggttttatacaaggg
taccatgtctatctgaaatccaaggcgaggcagtgccacccacgatttgaaaaggcagtt
ctttcagatggttcagaatgttgcaaatacaaaattgacaacccggaagaaaaggcattg
attgtggacaacctaaagccggaatccttctatgagtttttcgtcacaccattcactagt
gctggtgaaggccccaatgctacgttcacgaaggtcacgactccggatgaacactccgcg
atgctgattcatatcctactgcccatggttttctgcgtcttgctcatcatggtcatgtgc
tacttgaaaagtcagtggatcaaggagacctgttatcctgacatccctgacccttacaag
agcagcatcctgtcattaataaaattcaaggagaaccctcacctaacaataatgaatgtc
agtgactgtatcccagatgctattgaagttgtaagcaagccagaagggacaaagatacag
ttcctaggcactaggaagtcactcacagaaactgagttgactaagcccaactacctttat
ctccttccaacagaaaagaatcactctggccctggcccctgcatctgttttgagaacttg
acctataaccaggcagcttctgactctggctcttgtggccatgttccagtacccccaaaa
gccccaagtatgctgggactaatgacctcacctgaaaatgtactaaaggcactagaaaaa
aactacatgaactccctgggagaaatcccagctggagaaacaagtttgaattatgtgtcc
cagttggcttcacccatgtttggagacaaggacagtctcccaacaaacccagtagaacca
ccacactgttcagagtataaaatgcaaatggcagtccccctgcgtcttgccttgcctccc
ccgaccgagaatagcagcctctcctcaattacccttttagatccaggtgaacactaccgc
taa

KEGG   Pongo abelii (Sumatran orangutan): 100441293
Entry
100441293         CDS       T01416                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha/beta receptor 2 isoform X1
  KO
K05131  interferon receptor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05160  Hepatitis C
pon05162  Measles
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100441293 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    100441293 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100441293 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100441293 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100441293 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    100441293 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    100441293 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100441293 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100441293 (IFNAR2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100441293 (IFNAR2)
   05171 Coronavirus disease - COVID-19
    100441293 (IFNAR2)
   05164 Influenza A
    100441293 (IFNAR2)
   05162 Measles
    100441293 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    100441293 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100441293 (IFNAR2)
   05169 Epstein-Barr virus infection
    100441293 (IFNAR2)
   05165 Human papillomavirus infection
    100441293 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100441293 (IFNAR2)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IFN receptor family
   100441293 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100441293
NCBI-ProteinID: XP_024095142
LinkDB
Position
21
AA seq 590 aa
MRLVCPSCLPGPHLRPQDPSRPLPGALHASPLLGVRFCCTPPRPTPPHQGCPGHRALATA
RYVKVKRRLKIAKMLLSQNAFIVRSLNLFLMVYISLVFGISHDSPDYTDESCTFKISLRN
FRSILSWELKNHSIVPTHYMLLYTIMSKPEDLKMVMNCANTTRSFCDLTDEWRSTHEAYV
TILEGFSGNTTLFSCSHNFWLAIDMSFEPPEFETVGFTNHINVMVKFPSIVEEELQFDLS
LVIEEQSEGIVKKHKPEIRGNMSGNFTYVIDKLIPNTNYCVSVYFEHSDEQAVIKSPLKC
TLLPPGQESESAESAKIGGIITVFLIALVLTSAIVTLKWIGYICLRNSLPKVLNFHNFLA
WPFLNLPPLEAMDMVEVIYINRKKKVWDYNYDDESDSDTEAAAPRTSGGGYTMHGLTVRP
LGQASATSTESQFIDPESEEEPDLPEVDVELPMTPKGSPQRLELLSGPCERRESPLQDPF
LEEDYSSTEGSRGRITFNVDLNSVFLRVLDDEDSDDLEEAPLMISSHPEEMVDPEGPDNV
QSSHLLASGEGTQPTFPSPSSEDLWSEDAPSDQSDTSESDVDLGDGYIMR
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgcggctagtgtgcccttcctgtctcccggggccgcacctgcgaccccaggacccctcc
cggcccctgcccggcgccctccacgcgtcgcccctgctgggagtccgcttttgttgcacc
cctccgcgtcccaccccaccccaccaaggatgcccaggacaccgggcacttgccactgca
agatatgtaaaagtcaagagaagactaaaaatagcaaagatgcttttgagccagaatgcc
ttcatcgtcagatcacttaatttgtttctcatggtgtatatcagcctcgtgtttggtatt
tcacatgattcgcctgattacacagatgaatcttgcactttcaagatatcattgcgaaat
ttccggtccatcttatcatgggaattaaaaaaccactccattgtaccaactcactatatg
ttgctgtatacaatcatgagtaaaccagaagatttgaagatggttatgaactgtgcaaat
accacaagatcattttgtgacctcacagatgagtggagaagcacacacgaggcctatgtc
accatcctagaaggattcagcgggaacacaaccttgttcagttgctcacacaatttctgg
ctggccatagacatgtcttttgaaccaccagagtttgagactgttggttttaccaaccac
attaatgtgatggtgaaatttccatctattgttgaggaagaattacagtttgatttatca
ctcgtcattgaagaacagtcagaggggattgttaagaagcataaacccgaaataagagga
aacatgagtggaaatttcacctatgtcattgacaagttaattccaaacacgaactactgt
gtatctgtttattttgagcacagtgatgagcaggcagtaataaagtctcccttaaaatgc
acccttcttccacctggccaggaatcagaatcagcagaatctgccaaaataggaggaata
attactgtgtttttgatagcgttggtcttgacaagtgccatagtgacactgaaatggatt
ggttatatatgcttaagaaacagcctccccaaagtcttgaattttcataactttttagcc
tggccatttcttaacctgccaccgttggaagccatggatatggtggaggtcatttacatc
aacagaaagaagaaagtgtgggattataattatgatgatgagagtgacagcgatactgag
gcagcagcgcccaggacaagtggcggtggctataccatgcatggactgactgtcaggcct
ctgggtcaggcctctgccacctctacagaatcccagtttatagatccagagtccgaggag
gagcctgacctgcctgaggttgacgtggagctccccatgacgccaaagggcagccctcag
cgcttggaactcttgagtgggccctgtgagaggagagagagtccactccaggaccctttt
ctggaagaggactacagctccactgaggggtctaggggcagaattaccttcaatgtggat
ttaaactctgtgtttttgagggttcttgatgatgaggacagtgacgacttagaagaagcc
cctctgatgatatcgtctcatccagaagagatggttgacccagagggtcctgacaatgtg
caatcaagccatttgctggccagcggggaagggacacagccaacctttcccagcccctct
tcagaggacctgtggtctgaagatgctccatctgatcagagtgacacttctgagtcagat
gttgaccttggggatggttatataatgagatga

KEGG   Pongo abelii (Sumatran orangutan): 100441311
Entry
100441311         CDS       T01416                                 

Gene name
IL13RA2
Definition
(RefSeq) interleukin-13 receptor subunit alpha-2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100441311 (IL13RA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100441311 (IL13RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100441311 (IL13RA2)
   04090 CD molecules [BR:pon04090]
    100441311 (IL13RA2)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL3 receptor family
   100441311 (IL13RA2)
CD molecules [BR:pon04090]
 Proteins
  100441311 (IL13RA2)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind DDE_Tnp_4
Other DBs
NCBI-GeneID: 100441311
NCBI-ProteinID: XP_009233466
Ensembl: ENSPPYG00000020645
UniProt: H2PWJ0
LinkDB
Position
X
AA seq 388 aa
MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLD
NFKECTVEYELKYRNIGSETWTTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQ
SSWAETTYWISPQGIPETKVQDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLDH
ALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLP
PGYLTFTRESLYEIKLKWSIPLGPIPARCLDYEIEIREDDTTLVTATVENETYTLKTTNE
TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLLKKTLLLFWGPFGFILILVIFVTG
LLLRKPNTYPKMNFSVIHEDFPYQETWY
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggctttcgtttgcttggctatcggatgcttatatacctttctgataagcacaacattt
ggctgtacttcatcttcagacaccgagataaaagttaaccctcctcaggattttgagata
gtggatcccggatacttaggttatctctatttgcaatggcaacccccactgtctctggat
aattttaaggaatgcacagtggaatatgaactaaaataccgaaacattggtagtgaaaca
tggacgaccatcattactaagaatctacattacaaagatgggtttgatcttaacaagggc
attgaagcgaagatacacacgcttttaccatggcaatgcacaaatggatcagaagttcaa
agttcctgggcagaaactacttattggatatcaccacaaggaattccagaaactaaagtt
caggatatggattgtgtatattacaattggcaatatttactctgttcttggaaacctggc
ataggtgtacttcttgataccaattacaacttgttttactggtatgagggcttggatcat
gcattacagtgtgtcgattacatcaaggctgatggacaaaatattggatgcagatttccc
tatttggaggcatcagactataaagatttctatatttgtgttaatggatcatcagagaac
aagcctatcagatccagttatttcacttttcagcttcaaaatatagttaaacctttgcca
ccaggctatcttacttttactcgggagagtttatatgaaatcaagctgaaatggagcata
cctttgggacctattccagcaaggtgtttagattatgaaattgagatcagagaagatgat
actaccttggtgactgctacagttgaaaatgaaacgtacaccttgaaaacaacaaatgaa
acccgacaattatgctttgtagtaagaagcaaagtgaatatttattgctcagatgatgga
atttggagtgagtggagtgataaacaatgctgggaaggtgaagacctattgaagaaaact
ttgctacttttctggggaccatttggtttcatcttaatattagttatatttgtaaccggt
ctgcttttgcgtaagccaaacacctacccgaaaatgaatttttctgtgatacatgaagac
tttccatatcaagagacatggtattga

KEGG   Pongo abelii (Sumatran orangutan): 100442383
Entry
100442383         CDS       T01416                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04066  HIF-1 signaling pathway
pon04217  Necroptosis
pon04380  Osteoclast differentiation
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05164  Influenza A
pon05168  Herpes simplex virus 1 infection
pon05200  Pathways in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100442383 (IFNGR2)
   04066 HIF-1 signaling pathway
    100442383 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100442383 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100442383 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100442383 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    100442383 (IFNGR2)
   04659 Th17 cell differentiation
    100442383 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100442383 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100442383 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100442383 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100442383 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100442383 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    100442383 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    100442383 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100442383 (IFNGR2)
   05140 Leishmaniasis
    100442383 (IFNGR2)
   05142 Chagas disease
    100442383 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100442383 (IFNGR2)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IFN receptor family
   100442383 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 100442383
NCBI-ProteinID: XP_024095130
LinkDB
Position
21
AA seq 335 aa
MRPTLLWSPLLLLGVFAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVV
YQVQFKYTDSKWFMADIMSIGVNCTQITTTECDFTAATSSAGFPMDFNVTLRLRAELGAL
HSAWVTMPWFQHYRNVTVGPPKNIEVTPAEGSLIIRFSSPFDIADTSTAFFCYYVHYWEK
GGIQQVKGPFRSNSISLDNLKPFRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADAS
TELQQVILISVGTFSLLLVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPI
LEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgcgaccgacgctgctgtggtcgccgctgctgctgctcggagtcttcgccgccgcggcc
ccgccagaccctctttcccagctgcccgctcctcagcacccgaagattcgcctgtacaac
gcagagcaggtcctgagttgggagccagtggccctgagcaatagcacgaggcctgttgtc
taccaagtgcagtttaaatacaccgacagtaaatggttcatggccgacatcatgtccata
ggggtgaattgtacgcagatcacaacaacagagtgtgacttcactgccgccacttcctca
gcaggcttcccaatggatttcaatgtcactctacgccttcgagctgagctgggagcactc
cattctgcctgggtgacaatgccttggtttcaacactatcggaatgtgactgtcgggcct
ccaaaaaacattgaggtgaccccagcagaaggctccctcatcatcaggttctcctctccc
tttgacatcgctgatacctccacggcctttttttgttattatgtccattactgggaaaaa
ggaggaatccaacaggtcaaaggccctttcagaagcaactccatttcactggataactta
aaacccttcagagtgtactgtttacaagtccaggcacaactgctttggaacaaaagtaac
atctttagagtcgggcatttaagcaacatatcttgctacgaaacaatggcagacgcctcc
actgagcttcagcaagtcatcctgatctccgtgggaacattttcgttgctgttggtgctg
gcaggagcctgtttcttcctggtcctgaaatacagaggcctgattaaatactggtttcac
actccaccaagcatcccgttacagatagaagagtatttaaaggacccaactcagcccatc
ttagaggccttggacaaggacagctcaccaaaagatgacgtctgggactctgtgtccatt
atctcgtttccagaaaaggagcaagaagatgttctccaaacactttga

KEGG   Pongo abelii (Sumatran orangutan): 100442754
Entry
100442754         CDS       T01416                                 

Gene name
IL10RB
Definition
(RefSeq) interleukin-10 receptor subunit beta isoform X1
  KO
K05135  interleukin 10 receptor beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04630  JAK-STAT signaling pathway
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100442754 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100442754 (IL10RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100442754 (IL10RB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100442754 (IL10RB)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100442754 (IL10RB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100442754 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100442754 (IL10RB)
   04090 CD molecules [BR:pon04090]
    100442754 (IL10RB)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL10/28 receptor family
   100442754 (IL10RB)
CD molecules [BR:pon04090]
 Proteins
  100442754 (IL10RB)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 100442754
NCBI-ProteinID: XP_024095146
Ensembl: ENSPPYG00000011373
LinkDB
Position
21
AA seq 327 aa
MGIGFEEKGCKCFCLIFIALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLS
YRIFQDKCMSTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGM
QVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVL
RNLDPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTNDETVPSWMVAGILMASVLMVCLAL
LGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVI
AEDSESGKQNPGDSCSLGTLPGQGPQS
NT seq 984 nt   +upstreamnt  +downstreamnt
atgggcatcggttttgaggaaaaaggttgtaaatgtttttgtcttattttcatagcattg
ggaatggtaccacctcccgaaaatgtcagaatgaattctgttaatttcaagaacattcta
cagtgggagtcacctgcttttgccaaagggaacctgactttcacagctcagtacctaagt
tataggatattccaagataaatgcatgagtactaccttgacggaatgtgatttctcaagt
ctttccaagtacggtgaccacaccttgagagtcagggctgaatttgcagatgagcattca
gactgggtaaacatcaccttctgtcctgtggatgacaccattattggaccccctggaatg
caagtagaagtacttgctgattctttacatatgcgtttcttagcccctaaaattgagaat
gaatacgaaacttggactatgaagaatgtgtataactcatggacttataatgtgcaatac
tggaaaaacggtactgatgaaaagtttcaaattactccccagtatgactttgaggtcctc
agaaacctggatccatggacaacttattgtgttcaagttcgagggtttcttcctgatcgg
aacaaagctggggaatggagtgagcctgtctgtgagcaaaccaccaatgacgaaacggtc
ccctcctggatggtggctggcatcctcatggcctcggtcctcatggtctgcctggcactc
ctcggctgcttcgccttgctgtggtgcgtttacaagaagacaaagtacgccttctcccct
aggaattctcttccacagcacctgaaagagtttttgggccatcctcatcataacacactt
ctgtttttctcttttccattgtcggatgagaatgatgttttcgacaagctaagtgtcatt
gcagaagactctgagagtggcaagcagaatcctggtgacagctgcagcctcgggaccctg
cctgggcagggaccccagagctag

KEGG   Pongo abelii (Sumatran orangutan): 100443118
Entry
100443118         CDS       T01416                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04217  Necroptosis
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100443118 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    100443118 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100443118 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100443118 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100443118 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    100443118 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    100443118 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100443118 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100443118 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100443118 (IFNAR1)
   05160 Hepatitis C
    100443118 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    100443118 (IFNAR1)
   05164 Influenza A
    100443118 (IFNAR1)
   05162 Measles
    100443118 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    100443118 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100443118 (IFNAR1)
   05169 Epstein-Barr virus infection
    100443118 (IFNAR1)
   05165 Human papillomavirus infection
    100443118 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100443118 (IFNAR1)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IFN receptor family
   100443118 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 100443118
NCBI-ProteinID: XP_024095202
Ensembl: ENSPPYG00000011374
LinkDB
Position
21
AA seq 558 aa
MMVALLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVT
FSFDYQKPGMDNWIKLPGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSF
TPFRKAQIGPPEVHVEAEDKAIVIHISPPGTKDSVMWALDGLSFTYSLVIWKNSSGVEER
IENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSV
QNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQ
KGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFHIRSLSDSFHIYIGAPKQSGNK
PVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSS
VFSDVVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSNID
EYFSEQSLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYGSQTSQDSGNYS
NEDESESKTSEELQQDFV
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgatggtcgccctcctgggcgcgacgaccctagtgctcgtcgccgtggcgccatgggtg
ttgtccgcagccgcaggtggaaaaaatctaaaatctcctcaaaaagtagaggtcgacatc
atagatgacaactttatcctgaggtggaacaggagcgatgagtctgtcgggaatgtgact
ttttcattcgattatcaaaaacctgggatggataattggataaaattgcctgggtgtcag
aatattactagtaccaaatgcaacttttcttcactcaagctgaatgtttatgaagaaatt
aaattgcgtataagagcagaaaaagaaaacacttcttcatggtatgaggttgactcattt
acaccatttcgcaaagctcaaattggtcctccagaagtacatgtagaagctgaagataag
gcaatagtgatacacatctctcctcctggaacaaaagatagtgttatgtgggctttggat
ggtttaagctttacatatagcttagttatttggaaaaactcttcaggtgtagaagaaagg
attgaaaatatttattccagacataaaatttataaactctcaccagagactacttattgt
ttaaaagttaaagcagcactacttacgtcatggaaaattggtgtctatagtccagtacat
tgtataaagaccacagttgaaaatgaactacctccaccagaaaacatagaagtcagtgtt
caaaatcagaactatgttcttaaatgggattatacatatgcaaacatgacgtttcaagtt
cagtggctccacgcctttttaaaaaggaatcctggaaaccatttgtataaatggaaacaa
atacctgactgtgaaaatgtcaaaactacccagtgtgtctttcctcaaaacgttttccaa
aaaggaatttaccttctccgcgtacaagcatctgatggaaataacacatctttttggtct
gaagagataaagtttgatactgaaatacaagctttcctacttcctccagtctttcacatt
agatcccttagtgattcattccatatctatattggtgctccaaaacagtctggaaacaag
cctgtgatccaggattatccactgatttatgaaattattttttgggaaaacacttcaaat
gctgagagaaaaattatcgagaaaaaaactgatgttactgttcctaatttgaaaccactg
actgtatattgtgtgaaagccagagcacacaccatggatgaaaagctgaataaaagcagt
gtttttagtgacgttgtgtgtgagaaaacaaaaccaggaaatacctctaaaatttggctt
atagttggaatttgtattgcattatttgctctcccgtttgtcatttatgctgcgaaagtc
ttcttgagatgcattaattatgtcttctttccatcacttaaaccttcttccaatatagat
gagtatttctctgaacagtcattgaagaatcttctgctttcaacttctgaggaacaaatc
gaaaaatgttttataattgaaaatataagcacaattgctacagtagaagaaactaatcaa
actgatgaagatcataaaaaatacggttcccaaactagccaagattcaggaaattattct
aatgaagatgaaagtgaaagtaaaacaagtgaagaactacagcaggacttcgtatga

KEGG   Pongo abelii (Sumatran orangutan): 100448006
Entry
100448006         CDS       T01416                                 

Gene name
MPL
Definition
(RefSeq) thrombopoietin receptor isoform X1
  KO
K05082  thrombopoietin receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100448006 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100448006 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100448006 (MPL)
   04090 CD molecules [BR:pon04090]
    100448006 (MPL)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  Prolactin receptor family
   100448006 (MPL)
CD molecules [BR:pon04090]
 Proteins
  100448006 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 100448006
NCBI-ProteinID: XP_024087743
Ensembl: ENSPPYG00000001449
LinkDB
Position
1
AA seq 635 aa
MPSWALFMITSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSVPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVVLNQTR
TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRNPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAVGGS
CLISGLQPGNSYWLQLRSEPDGISLSGSWGSWSLPVTVDLPGDAVAIGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGAVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
ARVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgccctcctgggccctcttcatgatcacctcctgcctcctcctggcccctcaaaacctg
gcccaagtcagcagccaagatgtctccttgctggcatcagactcagagcccctgaagtgt
ttctcccgaacatttgaggacctcacttgcttctgggatgaggaagaggcagcgcccagt
gggacataccagctgctgtatgcctacccgcgggagaagccccgtgcttgccccctgagt
tcccagagtgtgccccactttggaacccgatacgtgtgccagtttccagaccaggaggaa
gtgcgtctcttctttccgctgcacctctgggtgaagaatgtggtcctaaaccagactcgg
actcagcgagtcctctttgtggacagtgtaggcctgccggctccccccagtatcatcaag
gccatgggtgggagccagccaggggaacttcagatcagctgggaggagccagctccagaa
atcagtgatttcctgaggtatgaactccgctatggccccagaaatcccaagaactccact
ggtcccacggtcatacagctgatcgccacagaaacctgctgccctgctctgcagaggcca
cactcagcctctgctctggaccagtctccatgtgctcagcccacaatgccctggcaagat
ggaccaaagcagacctccccaagtagagaagcttcagctctgacagcagtgggtggaagc
tgcctcatctcaggactccagcctggcaactcctactggctgcagctgcgcagcgaacct
gatgggatctccctcagtggctcctggggatcctggtccctccctgtgactgtggacctg
cctggagatgcagtggcaattggactgcaatgctttaccttggaccttaagaatgttacc
tgtcaatggcagcaacaggaccatgctagctcccaaggcttcttctaccacagcagggca
cggtgctgccccagagacaggtaccccatctgggagaactgcgaagaggaagagaaaaca
aatccaggattacagaccccacagttctctcgctgccacttcaagtcacgaaatgacagc
attattcacatccttgtggaggtgaccacagccccgggtgctgttcacagctacctgggc
tcccctttctggatccaccaggctgtgcgcctccccaccccaaacttgcactggagggag
atctccagcgggcatctggaattggagtggcagcacccatcgtcctgggcagcccaagag
acctgctatcaactccgatacacaggagaaggccatcaggactggaaggtgctggagccg
cctctcggggcccgaggagggaccctggagctgcgcccgcgatctcgctaccgtttacag
ctgcgcgccaggctcaacggccccacctaccaaggtccctggagctcgtggtcggaccca
gctagggtggagacagccaccgagaccgcctggatctccttggtgacggctctgcatcta
gtgctgggcctcagcgccgtcctgggcctgctgctgctgaggtggcagtttcctgcacac
tacaggagactgaggcatgccctgtggccctcacttccagacctgcaccgggtcctaggc
cagtacctcagggacactgcagccctgagtccgcccaaggccacagtctcagatacctgt
gaagaagtggaacccagcctccttgaaatcctccccaagtcctcagagaggactcctttg
cccctgtgttcctcccaggcccagatggactaccgaagattgcagccttcttgcctgggg
accatgcctctgtctgtgtgcccacccatggctgagtcaggatcctgctgtaccacccac
attgccaaccattcctacctaccactaagctattggcagcagccttga

KEGG   Pongo abelii (Sumatran orangutan): 100449812
Entry
100449812         CDS       T01416                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha
  KO
K05071  interleukin 4 receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon05200  Pathways in cancer
pon05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100449812 (IL4R)
   04151 PI3K-Akt signaling pathway
    100449812 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100449812 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100449812 (IL4R)
   04658 Th1 and Th2 cell differentiation
    100449812 (IL4R)
   04659 Th17 cell differentiation
    100449812 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100449812 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100449812 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100449812 (IL4R)
   04090 CD molecules [BR:pon04090]
    100449812 (IL4R)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100449812 (IL4R)
CD molecules [BR:pon04090]
 Proteins
  100449812 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 100449812
NCBI-ProteinID: XP_024089279
Ensembl: ENSPPYG00000007213
LinkDB
Position
16
AA seq 826 aa
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYLSISTCEWKMNGPTNCSTELRL
LYQLVFLLSETHTCVPENNGGAGCVCHLLMDDMVSADNYTLDLWAGQQLLWKGSFKPSEH
VKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYL
EPSLRIAASTLKSGISYRARVRAWARWYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSIS
CLVILAVCVLCYVSITKIKKEWWDQIPNPARSRLVAIIIQDAPVSQWEKRSRGQEPAKCP
HWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVR
CVELFEAPVECEEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGGEN
GGFCQQDMGESCLLPSSGSTSAHMPWDEFPSAGPKKAPPWGKEQPLHLEPSPPASPTQSP
DNLTCTETPLVIADNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEP
TTVPQPEPETWEQILRRNVLQHGAAAAPISAPTSGYREFVHAVEQGGTQASVVVGLGPPG
EAGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPGCPGDPAPVPVPLFTFGLDR
EPPRSPQSSHLPSSSPEHLGLEPGEKVEDVPKPPLPQEQATDPLGDSLGSGIVYSALTCH
LCGHLKQCHGQEDDGQTPVVASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLEASLCPAS
LAPSGISEKSKSSSSFHLAPGNAQSSSPTPKIVNFVSVGPTYMRVS
NT seq 2481 nt   +upstreamnt  +downstreamnt
atggggtggctttgctctgggctcctgttccctgtgagctgcctggtcctgctgcaggtg
gcaagctctgggaacatgaaggtcctgcaggagcccacctgcgtctccgactacttgagc
atctctacttgcgagtggaagatgaatggtcccaccaattgcagcaccgagctccgcctg
ttgtaccagctggtttttctgctctccgaaacccacacgtgtgtccccgagaacaatgga
ggcgcggggtgcgtgtgccacctgctcatggatgacatggtcagtgcagacaactatacg
ctggacctgtgggctgggcagcagctgctgtggaagggctccttcaagcccagcgagcat
gtgaaacccagggccccaggaaacctcacagttcacaccaatgtctccgacactctgctg
ctgacctggagcaacccgtatccccctgacaattacctgtataatcatctcacctatgca
gtcaacatttggagtgaaaacgacccggcagatttcagaatctataacgtgacctaccta
gaaccctccctccgcatcgcagccagcaccctgaagtctgggatttcctacagggcacgg
gtgagggcctgggctcggtggtataacaccacctggagtgagtggagccccagcaccaag
tggcacaactcctacagggagcccttcgagcagcacctcctgctgggcgtcagcatttcc
tgccttgtcatcctggccgtctgcgtgttgtgctatgtcagcatcaccaagattaagaaa
gaatggtgggatcagattcccaacccagcccgcagccgcctcgtggctataataatccag
gatgctccggtgtcacagtgggagaagcggtcccgaggccaggaaccagccaagtgccca
cactggaagaattgtcttaccaagctcttgccctgttttctggagcacaacatgaaacgg
gatgaggatccccacaaggctgccaaagagatgcctttccagggctctggaaaatcagca
tggtgcccggtggagatcagcaagacagtcctctggccagagagcatcagcgtggtgcga
tgcgtggagttgtttgaggccccggtggagtgtgaggaggaggaggaggaggtagaggaa
gaaaaagggagcttctgtgcatcgcctgagagcagcagggatgacttccaggagggaagg
gagggcattgtggcccggctaacagagagcttgttcctggacctgctcggaggggagaat
gggggcttttgccagcaggacatgggggagtcgtgccttcttccatcttcaggaagtacg
agtgctcacatgccctgggatgagttcccaagtgcagggcccaagaaggcacctccctgg
ggcaaggagcagcctcttcacctggagccgagtcctcctgccagcccgacccagagtcca
gacaacctgacttgcacagagacacccctcgtcatcgcagacaaccccgcttaccgcagc
ttcagcaactccctgagccagtcaccgtgtcccagagagctgggtccagacccactgctg
gccagacacctggaggaagtggaacccgagatgccctgtgtcccccagctctctgagcca
accactgtgccccaacctgagccagaaacctgggagcagatcctccgccgaaatgtcctc
cagcacggggcggctgcagcccccatctcggcccccaccagtggctatcgggagtttgta
catgcggtggagcagggtggcacccaggccagtgtggtggtgggcttgggtcccccagga
gaggctgggtacaaggccttctcaagcctgcttgccagcagtgccgtgtccccggagaaa
tgcgggtttggggctagcagtggggaagaggggtataagcctttccaagacctcattcct
ggctgccctggggaccctgccccagtccctgtccccttgttcacctttggactggacagg
gagccacctcgcagcccgcagagctcacatctcccaagcagctccccagagcacctgggt
ctggagccaggggaaaaggtagaggacgtgccgaagcccccacttccccaggagcaggcc
acagacccccttggggacagcctgggcagtggtattgtctactcagccctcacctgccac
ctgtgcggccacctgaagcagtgtcatggccaggaggatgatggccagacccctgtcgtg
gccagtccctgctgtggctgctgctgtggagacaggtcctcgccccctacaacccccctg
agggccccagacccctctccaggtggggttccactggaggccagcctgtgtccggcctcc
ctggcaccctcgggcatctcagagaagagtaaatcctcatcgtccttccatcttgcccct
ggcaatgctcagagctcaagcccgacccccaaaatcgtgaactttgtctccgtgggaccc
acatacatgagggtctcttag

KEGG   Pongo abelii (Sumatran orangutan): 100450173
Entry
100450173         CDS       T01416                                 

Gene name
IFNLR1
Definition
(RefSeq) interferon lambda receptor 1 isoform X2
  KO
K05140  interferon lambda receptor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100450173 (IFNLR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100450173 (IFNLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100450173 (IFNLR1)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL10/28 receptor family
   100450173 (IFNLR1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100450173
NCBI-ProteinID: XP_002811332
Ensembl: ENSPPYG00000001722
UniProt: A0A2J8SIW7
LinkDB
Position
1
AA seq 494 aa
MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQ
SSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYL
FEVEPAPPVLVLTQTEEILSASATYQLPPCMPPLDLKYEVAFWKEGAGNKTLLPVTPHGQ
PVLITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWAFLVLPSLLIPLL
VIAAGGVIWKSLMGNPWFQRAKMPRALELTRGVRPMPRVRAPATQQAGWKKDVAQDEEEE
DEEDTEDGVSFQPYIEPPSFLGQEHQAPGHSEAGGVDSGRPRAPLVPSEGSSAWDSSDRS
WASTVDSSWDRAGFSGYLAEKGPGQGSGGDRHQESLPPPEFSKDSGFLEELPEDDLSSWA
TWGTLPPEPNLVPGGPPVSLRTLTFCWESSPEEEEEEEEVRESETEDSDAGSWGAESTQR
TEERGRTLGHYMAR
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggccgggcccgagcgctggggccccctgctcctgtgcctgctgcaggccgctccaggg
aggccccgtctggcccctccccagaatgtgacactgctctcccagaacttcagcgtgtac
ctgacgtggctcccagggcttggcaacccccaggatgtgacctattttgtggcctatcag
agctctcccacccgtagacggtggcgtgaagtggaagagtgtgcaggaaccaaggagctg
ctatgttctatgatgtgcctgaagaaacaggacctgtacaacaaattcaaggggcgcgtg
cggacggtttctcccagctccaagtccccctgggtggagtctgaatacctggattatctt
tttgaagtggagccggccccacctgtcctggtgctcacccagacggaggagatcctgagt
gccagtgccacgtaccagctgcccccctgcatgcccccactggatctgaagtatgaggtg
gcattctggaaggagggggccggaaacaagaccctacttccagtcactccccatggccag
ccagtcctgatcaccctccagccagctgccagcgaacaccactgcctcagtgccagaacc
atctacaccttcagtgtcccgaaatacagcaagttctctaagcccacctgcttcttgctg
gaggtcccagaagccaactgggctttcctggtgctgccatcacttctgataccactgtta
gtaattgccgcagggggtgtgatctggaagagcctcatggggaacccctggtttcagcgg
gcaaagatgccacgggccctggaactgaccagaggggtcaggccgatgcctagagtcagg
gccccagccacccaacaggcaggatggaagaaggacgttgcacaggacgaggaggaggag
gatgaggaggacacagaagatggcgtcagcttccagccctacattgaaccaccttctttc
ctggggcaagagcaccaggctccagggcactcggaggctggtggggtggactcagggagg
cccagggctcctctggtcccaagcgaaggctcctctgcttgggattcttcagacagaagc
tgggccagcactgtggactcctcctgggacagggctgggttctctggctatttggctgag
aaggggccaggccaagggtcgggtggggacaggcaccaagaatctctcccaccgcctgaa
ttctccaaggactcgggtttcctggaagagctcccagaagatgacctctcctcctgggcc
acctggggcaccttaccaccggagccgaatctggtccctgggggacccccagtttctctt
cggacactgaccttctgctgggaaagcagccctgaggaggaagaggaggaagaggaggtg
agggaatcagaaaccgaggacagtgatgcgggcagctggggggctgagagcacccagagg
accgaggagaggggccggacattggggcattacatggccaggtga

KEGG   Pongo abelii (Sumatran orangutan): 100450175
Entry
100450175         CDS       T01416                                 

Gene name
IL21R
Definition
(RefSeq) interleukin-21 receptor isoform X2
  KO
K05075  interleukin 21 receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04659  Th17 cell differentiation
pon05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100450175 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100450175 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100450175 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100450175 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100450175 (IL21R)
   04090 CD molecules [BR:pon04090]
    100450175 (IL21R)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100450175 (IL21R)
CD molecules [BR:pon04090]
 Proteins
  100450175 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N Phage_holin_T EpoR_lig-bind
Other DBs
NCBI-GeneID: 100450175
NCBI-ProteinID: XP_003778635
Ensembl: ENSPPYG00000007214
UniProt: A0A6D2XZZ1 A0A2J8TJF8
LinkDB
Position
16
AA seq 538 aa
MLRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKD
EATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKP
APPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
RSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL
LLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFVPLYKGCSGDFKKWVGAPFTGSS
LELGPWSPEMPSTLEVYSCHPPQSPAKRLQLTELQEPAELVESDGVTKPSFWPTAQNSGG
SAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLG
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGS
PPAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgctgcgtggctgggccgcccccttgctcctgctgctgctccagggaggctggggctgc
cccgacctcgtctgctacaccgattacctccagacggtcatctgcatcctggagatgtgg
aacctccaccccagcacgctcacccttacctggcaagaccagtatgaagagctgaaggat
gaggccacctcctgcagcctccacagatcggcccacaatgccacgcacgccacctacacc
tgccacatggatgtattccacttcatggccgacgacattttcagtgttaacatcacagac
cagtctggcaactactcccaggagtgtggcagctttctcctggctgagagcatcaagccg
gctccccctttcaacgtgaccgtgaccttctcaggacagtataatatctcctggcgctca
gattacgaagaccctgccttctacatgctgaagggcaagcttcagtatgagctgcagtac
aggaaccggggagacccctgggctgtgagtccgaggagaaagctgatctcagtggactca
agaagtgtctccctcctccccctggagttccgcaaagactcgagctatgagctgcaggtg
cgggcagggcccatgcctggctcctcctaccaggggacctggagtgagtggagtgacccg
gtcatctttcagacccagtcagaggagttaaaggaaggctggaaccctcacctgctgctt
ctcctcctgcttgtcatagtcttcattcctgccttctggagcctgaagacccacccattg
tggaggctatggaagaagatatgggccgtccccagccctgagcggttcttcgtgcccctg
tacaagggctgcagcggagacttcaagaaatgggtgggtgcacccttcactggctccagc
ctggagctgggaccctggagtccagagatgccctccaccctggaggtgtacagctgccac
ccaccacagagcccggccaagaggctgcagctcacggagctacaagaaccagcagagctg
gtggagtctgatggtgtgaccaagcccagcttctggccgacggcccagaactcggggggc
tcagcttacagtgaggagagggaccggccgtatggcctggtgtccattgacacagtgact
gtgctagatgcagaggggccatgcacctggccctgcagctgtgaggatgacggctaccca
gccctggacctggacgctggcctggagcccagcccaggcctagaggacccactcttgggt
gcagggaccacagtcctctcctgtggctgtgtctcagctggcagccctgggctaggaggg
cccctgggaagcctcttggacagactaaagccaccccttgcagatggggaggactgggct
gggggactgccctggggtggccggtcgcctggaggagtctcagagagtgaggcgggctca
cccccggccggcctggatatggacacgtttgacagtggcttcgtgggctctgactgcagc
agccctgtggagtgtgacttcaccagccccggggacgaaggaccgccccgaagctacctc
cgccagtgggtggtcattcctccgccactttcgagccctggaccccaggccagctag

KEGG   Pongo abelii (Sumatran orangutan): 100450437
Entry
100450437         CDS       T01416                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin-5 receptor subunit alpha isoform X2
  KO
K05067  interleukin 5 receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100450437 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100450437 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100450437 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450437 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100450437 (IL5RA)
   04090 CD molecules [BR:pon04090]
    100450437 (IL5RA)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL3 receptor family
   100450437 (IL5RA)
CD molecules [BR:pon04090]
 Proteins
  100450437 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac LIFR_D2
Other DBs
NCBI-GeneID: 100450437
NCBI-ProteinID: XP_002813550
Ensembl: ENSPPYG00000013703
UniProt: H2PA81
LinkDB
Position
3
AA seq 422 aa
MDMIIVAPVLLILLGATKILQADLLPDEKISLLPPVNFTIKVTGLAQVLLHWKPNPDQEQ
RNVNLEYQVKINAPKEDDYETGITESKCVTILHKGFSASVRTILQNDHSLLASSWVSAEL
HAPPGSPGTSIVNLTCTTNTTEDNYSHLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSW
TEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIKPFDQLFALHAIDQ
INPPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKMMTNAFISII
DDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLRKWFLIVLMATICFILLIL
SLVCKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDS
VF
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggatatgatcatcgtggcacctgtattactgattcttttgggggccactaagatactg
caagctgacttacttcctgatgaaaagatttcacttctcccacctgtcaatttcaccatt
aaagttactggtttggctcaagttcttttacattggaaaccaaatcctgatcaagagcaa
aggaatgttaatcttgaatatcaagtgaaaataaacgctccaaaagaagatgactatgaa
accggaatcactgaaagcaaatgtgtaaccatcctccacaaaggcttttcagcaagtgtg
cggaccatcctgcagaacgaccactcactactggccagcagctgggtttctgctgaactt
catgccccaccagggtctcctggaacctcaattgtgaatttaacttgcaccacaaacact
acagaagataattattcacatttaaggtcataccaagtttcccttcactgcacctggctt
gttggcacagatgcccctgaggacacgcagtattttctctactataggtatggctcttgg
actgaagaatgccaagaatacagcaaagacacactggggagaaatatcgcatgctggttt
cccaggacttttatcctcagcaaagggcgtgactggcttgcggtgcttgttaacggctcc
agcaagcactctgccatcaagccctttgatcagctgtttgcccttcacgccattgatcaa
ataaatcctccactgaatgtcacagcagagattgaaggaactcgtctctctatccaatgg
gagaaaccagtgtctgcctttccaatccattgctttgattatgaagtaaaaatacacaat
acaaggaacggatatttgcagatagaaaaaatgatgaccaatgcattcatctcaataatt
gatgatctttctaagtacgatgttcaagtgagagcagcagtgagctccatgtgcagagag
gcggggctctggagtgagtggagccaacctatttatgtgggaaatgatgaacacaagccc
ttgagaaagtggtttctcattgtgcttatggcaaccatctgcttcatcttgttaattctc
tcgctcgtctgtaaaatatgtcatttatggatcaagttgtttccaccaattccagcacca
aaaagtaatatcaaagatctctttgtaaccactaactatgagaaagctgggtccagtgag
acggaaattgaagtcatctgttatatagagaagcctggagttgagaccctggaggattct
gtgttttga

KEGG   Pongo abelii (Sumatran orangutan): 100451189
Entry
100451189         CDS       T01416                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor isoform X2
  KO
K05080  growth hormone receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100451189 (GHR)
   04151 PI3K-Akt signaling pathway
    100451189 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100451189 (GHR)
   04060 Cytokine-cytokine receptor interaction
    100451189 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100451189 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100451189 (GHR)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  Prolactin receptor family
   100451189 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 100451189
NCBI-ProteinID: XP_003776629
Ensembl: ENSPPYG00000015431
UniProt: A0A6D2YB15 A0A2J8WBK2
LinkDB
Position
5
AA seq 638 aa
MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPE
RETFSCHWTDAVYHGSKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTS
IWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPPN
ADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVRVRSKQRNSGNY
GEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGIDPDLFKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKTEGS
DTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQPQRLKGE
ADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSS
LANNDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADA
KKCIPVAPHVKVESHIQPSFNQEDIYITTESLTTAAGRPGTAEHVPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggatctctggcagctgctgttgaccttggcactggcaggatcaagtgatgctttttct
ggaagtgaggccacagcagctatccttagcagagcaccctggagtctgcaaagtgttaat
ccaggcctaaagacaaattcttctaaggagcctaaattcaccaagtgccgttcacctgag
cgagagactttttcatgccactggacagatgcagtttatcatggttcaaagaacctagga
cccatacagctattctataccagaaggaacactcaagaatggactcaagaatggaaagaa
tgccctgattatgtttctgctggggaaaacagctgttactttaattcatcatttacctcc
atctggataccttattgtatcaagctaactagcaatggtggtacagtggatgaaaagtgt
ttctctgttgacgaaatagtgcaaccagatccacccattgccctcaactggactttactg
aacgtcagtttaactgggattcatgcagatatccaagtgagatgggaagcaccacccaat
gcagatattcagaaaggatggatggttctggagtatgaacttcaatacaaagaagtaaat
gaaactaaatggaaaatgatggaccctatattgtcaacatcagttccagtgtactcattg
aaagtggataaggaatatgaagtgcgtgtgagatccaaacaacgaaactctggaaattat
ggcgagttcagtgaggtgctctatgtaacacttcctcagatgagccaatttacatgtgaa
gaagatttctactttccatggctcttaattattatctttggaatatttggactaacggtg
atgctatttgtattcttattttctaaacagcaaaggattaaaatgctgattctgccccca
gttccagttccaaagattaaaggaatcgatccagatctcttcaaggaaggaaaattagag
gaggtgaacacaatcttagccattcatgatagctataaacccgaattccacagtgatgac
tcttgggttgaatttattgagctagatattgatgagccagatgaaaagactgagggatca
gacacagacagacttctaagcagtgaccatgagaaatcacatagtaacctaggggtgaag
gatggtgactctggacgtaccagctgttgtgaacctgacattctggagactgatttcaat
gccaatgacatacatgagggtacctcagaggttgctcagccacagaggttaaaaggggaa
gcagatctgttatgccttgaccagaagaatcaaaataactcaccttatcatgatgcttgc
cctgctactcagcagcccagtgttatccaagcagagaaaaacaaaccacaaccacttcct
actgaaggagctgagtcaactcaccaagctgcccatattcagctaagcaatccaagttca
ctggcaaacaacgacttttatgcccaggtgagcgacattacaccagcaggtagtgtggtc
ctttccccgggccaaaagaataaggcagggatgtcccagtgtgacatgcacccggaaatg
gtctcactctgccaagaaaacttccttatggacaatgcctacttctgtgaggcagatgcc
aaaaagtgcatccctgtggctcctcacgtcaaggttgaatcacacatacagccaagcttt
aaccaagaggacatttacatcaccacagaaagccttaccactgctgctgggaggcctggg
acagcagaacatgttccaggttctgagatgcctgtcccagactatacctccattcatata
gtacagtccccacagggcctcatactcaatgcgactgccttgcccttgcctgacaaagag
tttctctcatcgtgtggctatgtgagcacagaccaactgaacaaaatcatgccttag

KEGG   Pongo abelii (Sumatran orangutan): 100451191
Entry
100451191         CDS       T01416                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin-6 receptor subunit beta isoform X1
  KO
K05060  interleukin 6 signal transducer
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04630  JAK-STAT signaling pathway
pon04659  Th17 cell differentiation
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100451191 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100451191 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100451191 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100451191 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100451191 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100451191 (IL6ST)
   05203 Viral carcinogenesis
    100451191 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100451191 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100451191 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100451191 (IL6ST)
   04090 CD molecules [BR:pon04090]
    100451191 (IL6ST)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100451191 (IL6ST)
CD molecules [BR:pon04090]
 Proteins
  100451191 (IL6ST)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind Pur_ac_phosph_N fn3_2 ObR_Ig DCP1
Other DBs
NCBI-GeneID: 100451191
NCBI-ProteinID: XP_024102830
Ensembl: ENSPPYG00000015475
LinkDB
Position
5
AA seq 935 aa
MPTPSLTNFVICKYPRKMLMLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSN
FTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTC
NILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDRGRETHLETNFTLKSE
WATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPN
PPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSS
FTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQG
YRTIQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYVATLTAR
NLVGKSDAAVLTIPACGFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDK
APCIADWQQEDGTVHRTHLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGP
TVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLT
SDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNK
RDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKP
FPEDLKSLDLFKKEKINTEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVV
HSGYRHQVPSVQVFSRSESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHE
SSPDISHFERSKQVSSVNEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEG
QVERFETVGMEAVIDEGMPKSYLPQTVRQGGYMPQ
NT seq 2808 nt   +upstreamnt  +downstreamnt
atgcctactccttcacttactaattttgtgatttgcaaatatccgcgcaagatgttgatg
ttgcagacttggctagtgcaagccttgtttattttcctcaccactgaatctacaggtgaa
cttctagatccatgtggttatatcagtcctgaatctccagttgtacaacttcattctaat
ttcactgcagtttgtgtgctaaaggaaaaatgtatggattattttcatgtaaatgctaat
tacattgtctggaaaacaaaccattttactattcctaaggagcaatatactatcataaac
agaacagcatccagtgtcacctttacagatatagcttcattaaatattcagctcacttgc
aacattcttacattcggacagcttgaacagaatgtttatggaatcacaataatttcaggc
ttgcctccagaaaaacctaaaaatttgagttgcattgtgaatgaggggaagaaaatgagg
tgtgagtgggatcgtggaagggaaacacacttggagacaaacttcactttaaaatctgaa
tgggcaacacacaagtttgctgattgcaaagcaaaacgtgacacccccacctcatgcact
gttgattattctactgtgtattttgtcaacattgaagtctgggtagaagcagagaatgcc
cttgggaaggttacatcagatcatatcaattttgatcctgtatataaagtgaagcccaat
ccgccacataatttatcagtgatcaactcagaggaactgtctagtatcttaaaattgacg
tggaccaacccaagtattaagagtgttataatactaaaatataatattcagtataggacc
aaagatgcctcaacttggagccagattcctcctgaagacacagcatccacccgatcttca
ttcactgtccaagaccttaaaccttttacagaatatgtgtttaggattcgctgtatgaag
gaagatggtaagggatactggagtgactggagtgaagaagcaagtgggatcacctatgaa
gatagaccatctaaagcaccaagtttctggtataaaatagatccatcccatactcaaggc
tacagaactatacaactcgtgtggaagacattgcctccttttgaagccaatggaaaaatc
ttggattatgaagtgactctcacaagatggaaatcacatttacaaaattacacagttaat
gccacaaaactgacagtaaatctcacaaatgatcgctatgtagcaactctaacagcaaga
aatcttgttggcaaatcagatgcagctgttttaactatccctgcctgtggctttcaagct
actcaccctgtaatggatcttaaagcattccccaaagataacatgctttgggtagaatgg
actactccaagggaatctgtaaagaaatatatacttgagtggtgtgtgttatcagataaa
gcaccctgtatcgcagactggcaacaagaagatggtaccgtgcatcgcacccatttaaga
gggaacttagcagagagcaaatgctatttgataacagttactccagtatatgctgacgga
ccaggaagccctgaatccataaaggcataccttaaacaagctccaccttccaaaggacct
actgttcggacaaaaaaagtagggaaaaacgaagctgtcttagagtgggaccaacttcct
gttgatgttcagaatggatttatcagaaattatactatattttatagaaccatcattgga
aatgaaactgctgtgaatgtggattcttcccacacagaatatacattgtcctctttgact
agtgacacattgtacatggtacgaatggcagcatacacagatgaaggtgggaaggatggt
ccagaattcacttttactaccccaaagtttgctcaaggagaaattgaagccatagtcgtg
cctgtttgcttagcattcctattgacaactcttctgggagtgctgttctgctttaataag
cgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaagagtcatatt
gcccagtggtcacctcacactcctccaaggcacaattttaattcaaaagatcaaatgtat
tcagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgacaaaaagcct
tttccagaagatctgaaatcactggacctgttcaaaaaggaaaaaattaatactgaagga
cacagcagtggtattggggggtcttcatgcatgtcatcttctaggccaagcatttctagc
agtgatgaaaatgaatcttcacaaaacacttcgagcactgtccagtactctactgtggta
cacagtggctacagacaccaagttccatcagtccaagtcttctcaagatccgagtctacc
cagcccttgttagattcagaggagcggccagaagatctacaattagtagatcatgtagat
ggcggtgatggtattttgcccaggcaacagtacttcaaacagaactgcagtcagcatgaa
tccagtccagatatttcacattttgaaaggtcaaagcaagtttcatcagtcaatgaggaa
gattttgttagacttaaacaacagatttcagatcatatttcacaatcctgtggatctggg
caaatgaaaatgtttcaggaagtttctgcagcagatgcttttggtccaggtactgaggga
caagtagaaagatttgaaacagttggcatggaggctgtgattgatgaaggaatgcctaaa
agttacttaccacagactgtacggcaaggcggctacatgcctcagtga

KEGG   Pongo abelii (Sumatran orangutan): 100452294
Entry
100452294         CDS       T01416                                 

Gene name
EPOR
Definition
(RefSeq) erythropoietin receptor isoform X1
  KO
K05079  erythropoietin receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100452294 (EPOR)
   04151 PI3K-Akt signaling pathway
    100452294 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100452294 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100452294 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452294 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100452294 (EPOR)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  Prolactin receptor family
   100452294 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 100452294
NCBI-ProteinID: XP_002828735
UniProt: A0A2J8S0G4
LinkDB
Position
19
AA seq 508 aa
MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDL
VCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRY
EVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV
SLLTPSDLDPLILTLSLILVLILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVG
SEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGAS
AASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL
SDGPYSNPYENSLIPAAEPLPPSYVACS
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggaccacctcggggcgtccctctggccccaggtcggctccctttgtctcctgctcgct
ggggccgcctgggcgcccccgcccaacctcccggaccccaagttcgagagcaaagcggcc
ttgctggcggcccgcgggcccgaagagcttctgtgcttcaccgagcggttggaggacttg
gtgtgtttctgggaggaagcggcgagcgctggggtgggcccgggcaactacagcttctcc
taccagctcgaggatgagccatggaagctgtgtcgcctgcaccaggctcccacggctcgt
ggtgcggtgcgcttctggtgttcgctgcccacagccgacacgtcgagcttcgtgccccta
gagttgcgcgtcacagcagcctccggcgctccgcgatatcaccgtgtcatccacatcaat
gaagtagtgctcctggacgcccccgtggggctggtggcgcggttggctgacgagagcggc
cacgtagtgttgcgctggctcccgccgcctgagacacccatgacgtcccacatccgctac
gaggtggacgtctcggccggcaacggcgcagggagcgtgcagagggtggagatcctggag
ggccgcaccgagtgtgtgctgagcaacctgcggggccggacgcgctacaccttcgccgtc
cgcgcgcgtatggctgagccgagcttcggcggcttctggagcgcctggtcggagcctgtg
tcgctgctgacgcctagtgacctggaccccctcatcctgacgctctccctcatcctcgtg
ctcatcctggtgctgctgaccgtgctcgcgctgctctcccaccgccgggctctgaagcag
aagatctggcctggcatcccgagcccagagagtgagtttgaaggcctcttcaccacccac
aagggtaacttccagctgtggctgtaccagaatgatggctgcctgtggtggagcccctgc
acccccttcacagaggacccacctgcttccctggaagtcctctcagagcgctgctggggg
acgatgcaggcagtggagccggggacagatgatgagggccccctgctggagccggtgggc
agtgagcatgcccaggatacctatctggtgctggacaagtggttgctgccccggaacccg
cccagtgaggacctcccagggcctggtggcagtgtggacatagtggccatggatgaaggc
tcagaagcatcctcctgctcatctgctttggcctcgaagcccagcccagagggagcctct
gctgccagctttgagtacactatcctggaccccagctcccagctcttgcgtccatggaca
ctgtgccctgagctgccccctaccccaccccacctaaagtacctgtaccttgtggtatct
gactctggcatctcaactgactacagctcaggggactcccagggagcccaagggggctta
tctgatggcccctactccaacccttatgagaacagccttatcccagctgctgagcctctg
ccccccagctatgtggcttgctcttag

KEGG   Pongo abelii (Sumatran orangutan): 100452320
Entry
100452320         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: granulocyte-macrophage colony-stimulating factor receptor subunit alpha-like
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100452320
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100452320
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100452320
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100452320
   04090 CD molecules [BR:pon04090]
    100452320
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL3 receptor family
   100452320
CD molecules [BR:pon04090]
 Proteins
  100452320
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind
Other DBs
NCBI-GeneID: 100452320
NCBI-ProteinID: XP_024097331
LinkDB
Position
X
AA seq 400 aa
MLLLVTSLLLCELPHPAFLLIPEKSDPPTVVPASSLNVRFDSRTMNLSWDCQENTTFSRC
FLTDKKNRVVEPRLNNNECSCTFREICLHGGVTFEVHVNTSQRGFQQKLLYLNSGREGTA
AQNFSCFIYNVDFMNCTWARGPTAPRDVQYFLYIQNSKRRREIRCPYYMQDSGTHVGCHL
DNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIEQFNPPGNVTVHCNTTHCIVRWKQP
RTYQKLSYLDFQYQLDVHRKNTQPGTENLLIDVSGDLENRYNFPSAEPRAKHSVKIRAAD
VRILNWSSWSEAAEFGSDDRNLSSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVP
QIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgcttctcctggtgacaagccttctgctctgtgagttgccacacccagcattcctcctg
atcccagagaaatcggatccgccaacagtggtaccagcctctagtctcaatgtgaggttt
gactccaggacgatgaatttaagctgggactgccaagaaaacacaaccttcagcaggtgt
ttcttaactgacaagaagaacagagtcgtggaacccaggctcaataacaatgaatgttcg
tgcacatttcgtgaaatttgtctgcatggaggagtcacttttgaggttcacgtgaatact
agccaaagaggatttcaacaaaaactgctttatctaaattcaggaagggagggtaccgct
gctcagaatttctcctgtttcatctacaatgtggatttcatgaactgtacctgggcgagg
ggtccgacggccccccgtgacgtccagtattttttgtacatacaaaactcaaagagaagg
agggagatccggtgtccttattacatgcaagactcgggaacccatgtgggatgtcacttg
gataacctgtcaggattaacgtctcgcaattacttcctggttaatggaaccagccgagaa
attggcatccaattcttcgattcacttttggacacaaagaaaatagaacaattcaaccct
ccgggcaatgtcaccgtacattgcaacacgacgcactgcatcgtacggtggaaacaaccc
aggacctaccagaagctgtcgtacctggactttcagtaccagctggacgtccacagaaag
aatacccagcctggcacggaaaacctactgattgatgtttctggtgatttggaaaataga
tacaactttccaagcgctgagcccagagcaaaacatagtgtgaagatcagagctgcagac
gtccgcatcctgaattggagttcgtggagtgaagctgctgaatttggctctgacgacaga
aacctcagctctgtgtacatttatgtgctcctgatcgtgggaacccttgtctgtggcatc
gtcctcggcttcctctttaaaaggttccttaggatacagcgactgttcccgccagttccg
cagatcaaagacaaactgaatgataatcatgaggtggaagacgagatcatctgggaggaa
ttcaccccagaggaagggaaaggctaccgagaagaggtcttgactgtgaaggaaattacc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100452697
Entry
100452697         CDS       T01416                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha isoform X1
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100452697
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100452697
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100452697
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452697
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100452697
   04090 CD molecules [BR:pon04090]
    100452697
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL3 receptor family
   100452697
CD molecules [BR:pon04090]
 Proteins
  100452697
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind
Other DBs
NCBI-GeneID: 100452697
NCBI-ProteinID: XP_024097323
LinkDB
Position
X
AA seq 437 aa
MLLLVTSLLLCELPHPAFLLIPEKSDPPTVVPASSLNVRFDSRTMNLSWDCQENTTFSRC
FLTDKKNRVVEPRLNNNECSCTFREICLHGGVTFEVHVNTSQRGFQQKLLYLNSGREGTA
AQNFSCFIYNVDFMNCTWARGPTAPRDVQYFLYIQNSKRRREIRCPYYMQDSGTHVGCHL
DNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPGNVTVHCNTTHCIVRWKQP
RTYQKLSYLDFQYQLDVHRKNTQPGTENLLIDVSGDLENRYNVPSAEPRAKHNVKIRAAD
VRILNWSSWSEAAEFGKHGVSLCHQAGVQRHDLSSLQPPPPGLKRFSCLSLPSSDDRNLS
SVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTP
EEGKGYREEVLTVKEIT
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgcttctcctggtgacaagccttctgctctgtgagttgccacacccagcattcctcctg
atcccagagaaatcggatccaccaacagtggtaccagcctctagtctcaatgtgaggttt
gactccaggacgatgaatttaagctgggactgccaagaaaacacaaccttcagcaggtgt
ttcttaactgacaagaagaacagagtcgtggaacccaggctcaataacaatgaatgttcg
tgcacatttcgtgaaatttgtctgcatggaggagtcacttttgaggttcacgtgaatact
agccaaagaggatttcaacaaaaactgctttatctaaattcaggaagggagggtaccgct
gctcagaatttctcctgtttcatctacaatgtggatttcatgaactgtacctgggcgagg
ggtccgacggccccccgtgacgtccagtattttttgtacatacaaaactcaaagagaagg
agggagatccggtgtccttattacatgcaagactcgggaacccatgtgggatgtcacctg
gataacctgtcaggattaacgtctcgcaattacttcctggttaatggaaccagccgagaa
attggcatccaattcttcgattcacttttggacacaaagaaaatagaacgattcaaccct
ccgggcaatgtcaccgtacattgcaacacgacgcactgcatcgtacggtggaaacaaccc
aggacctaccagaagctgtcgtacctggactttcagtaccagctggacgtccacagaaag
aatacccagcctggcacggaaaacctactgattgatgtttctggtgatttggaaaataga
tacaacgttccaagcgctgagcccagagcaaaacataatgtgaagatcagagctgcagat
gtccgcatcctgaattggagttcgtggagtgaagctgctgaatttggtaagcacggagtc
tcgctctgtcaccaggctggagtgcaacggcacgatctcagctcactgcaacctccgcct
cccgggctcaagcgattctcctgcctcagcctcccgagctctgacgacagaaacctcagc
tctgtgtacatttatgtgctcctgatcgtgggaacccttgtctgtggcatcgtcctcggc
ttcctctttaaaaggttccttaggatacagcgactgttcccgccagttccgcagatcaaa
gacaaactgaatgataatcatgaggtggaagacgagatcatctgggaggaattcacccca
gaggaagggaaaggctaccgagaagaggtcttgactgtgaaggaaattacctga

KEGG   Pongo abelii (Sumatran orangutan): 100454377
Entry
100454377         CDS       T01416                                 

Gene name
IL22RA1
Definition
(RefSeq) interleukin-22 receptor subunit alpha-1 isoform X1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100454377 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100454377 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100454377 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100454377 (IL22RA1)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL10/28 receptor family
   100454377 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100454377
NCBI-ProteinID: XP_024113057
Ensembl: ENSPPYG00000001723
LinkDB
Position
1
AA seq 575 aa
MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTY
GERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTT
LKPPDVTCIPKVRSIQMIVHPTPTPIRAGDGHQLTLEDIFHDLLFYHLELQVNRTYQMHL
GGKQREYEFFGLTPDTEFLGTIMICVPTWSKESAPYMCRVKTLPDRTWTYSFSGAFLFSM
GFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPV
QYSQIRVSEPREPAGAPQRHSLSEITYLGQPDISILQPSNMPPPQILSSLSYAPNAAPEV
GPPSYAPQVTPEAQLPFYTPQAISKVQPPSYAPQATPDSWPPSYGVCMEGSGKDSPTGTL
SSPKHLRPKGQLQKEPPAGSCMSGGLSLQEVTSLAMEESQEEKSLHQPLGICTDRTSDPN
VLHSGEEGTPQYLKSQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLDSLVCP
KDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgaggacgctgctgaccatcttgactgtgggatccctggctgctcacgcccctgaggac
ccctcggatctgctccagcacgtgaaattccagtccagcaactttgaaaacatcctgacg
tgggacagcgggccggagggcaccccagacacggtctacagcatcgagtataagacgtac
ggagagagggactgggtggcaaagaagggctgtcagcggatcacccggaagtcctgcaac
ctgacggtggagacgggcaacctcacggagctctactatgccagggtcaccgctgtcagc
gcgggaggccgatcagccaccaagatgactgacaggttcagctctctgcagcacactacc
ctcaaaccacctgatgtgacctgtatccccaaagtgagatcgattcagatgattgttcat
cctacccccacacccatccgtgcaggggatggccaccagctaaccctggaagacatcttc
catgacctgttgttctaccacttagagctccaggtcaaccgcacctaccaaatgcacctt
ggagggaagcagagagaatatgagttcttcggcctgacccctgacacagagttccttggc
accatcatgatttgtgttcccacctggtccaaggagagtgccccctacatgtgccgagtg
aagacactgccagaccggacgtggacctactccttctccggagccttcctgttctccatg
ggcttcctcgtcgcagtgctctgctacctgagctacagatatgtcaccaagccacctgca
cctcccaactccctgaatgtccagcgagtcctgactttccagccgctgcgcttcatccag
gagcacgtcctgatccctgtctttgacctcagcggccccagcagtctggcccagcctgtc
cagtactcccagatcagggtgtctgaacccagggaacccgcaggagctccacagcggcac
agcctgtccgagatcacctacttagggcagccggacatctccatcctccagccctccaac
atgccacctccccagatcctctcctcactgtcctatgccccaaacgctgcccctgaggtc
gggcccccatcctatgcacctcaggtgacccccgaagctcaactcccattctacacccca
caggccatctctaaggtccagcctccctcctatgcccctcaagccactccagacagctgg
cctccctcctatggggtatgcatggaaggttctggcaaagactcccccactgggacactt
tctagtcctaaacaccttaggcctaaaggtcagcttcagaaagagccaccagctggaagt
tgcatgtcaggtggcctttctctgcaggaggtgacctccttggctatggaggaatcccaa
gaagaaaaatcattgcaccagcccctggggatttgcacagacagaacatctgacccaaat
gtgctacacagtggggaggaagggacaccacagtacctaaagagccagctccccctcctc
tcctcagtccagatcgagggccaccccatgtccctccctttgcaacctccttcccgtccc
tgttccccctcagaccagggtccaagtccctggggcctgctggattcccttgtgtgtccc
aaggatgaagccaagagcccagcccctgagacctcagacctggagcagcccacagaactg
gattctcttttcagaggcctggccctgaccgtgcagtgggagtcctga

KEGG   Pongo abelii (Sumatran orangutan): 100454903
Entry
100454903         CDS       T01416                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma isoform X1
  KO
K05070  interleukin 2 receptor gamma
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05321  Inflammatory bowel disease
pon05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100454903 (IL2RG)
   04151 PI3K-Akt signaling pathway
    100454903 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100454903 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100454903 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100454903 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100454903 (IL2RG)
   04659 Th17 cell differentiation
    100454903 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454903 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100454903 (IL2RG)
   05340 Primary immunodeficiency
    100454903 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100454903 (IL2RG)
   05162 Measles
    100454903 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100454903 (IL2RG)
   04090 CD molecules [BR:pon04090]
    100454903 (IL2RG)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100454903 (IL2RG)
CD molecules [BR:pon04090]
 Proteins
  100454903 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3 IL4Ra_N
Other DBs
NCBI-GeneID: 100454903
NCBI-ProteinID: XP_009233240
Ensembl: ENSPPYG00000020446
UniProt: H2PVY5 A0A6D2WMT9
LinkDB
Position
X
AA seq 369 aa
MLKPSLPFRSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTSMPADSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGVLGEGPGASPCNQHSPYWAP
PCYTLKPET
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaagccatcattaccattcagatccctcttattcctgcagctgcccctgctggga
gtggggctgaacacgacaattctgacgcccaatgggaatgaagacaccacagctgatttc
ttcctgacctctatgcccgctgactccctcagtgtttccactctgcccctcccagaggtt
cagtgttttgtgttcaatgtcgagtacatgaattgcacttggaacagcagctctgagccc
cagcctaccaacctcactctgcattattggtacaagaactcagataatgataaagtccag
aagtgcagccactatctattctctgaagaaatcacttctggctgtcagttgcaaaaaaag
gagatccacctctaccaaacatttgttgttcagctccaggacccacgggaacccaggaga
caggccacacagatgctaaaactgcagaatctggtgatcccctgggctccagagaaccta
acacttcacaaactgagtgaatcccagctagaactgaactggaacaacagattcttgaac
cactgtttggagcacttggtgcagtaccggactgactgggaccacagctggactgaacaa
tcagtggattatagacataagttctccctgcctagtgtggatgggcagaaacgctacacg
tttcgtgttcggagccgctttaacccactctgtggaagtgctcagcattggagtgaatgg
agccacccaatccactgggggagcaatacttcaaaagagaatcctttcctgtttgcgttg
gaagccgtggttatctccgttggctccatgggattgattatcagccttctctgtgtgtat
ttctggctggaacggacgatgccccgaattcccaccctgaagaacctagaggatcttgtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaagggactggctgagagt
ctgcagccagactacagtgaacgactctgcctcgtcagtgagattcccccaaaaggaggg
gtcctcggggaggggcctggggcctccccatgcaaccagcatagcccctactgggccccc
ccatgttacaccctgaagcctgaaacctga

KEGG   Pongo abelii (Sumatran orangutan): 100455669
Entry
100455669         CDS       T01416                                 

Gene name
CNTFR
Definition
(RefSeq) ciliary neurotrophic factor receptor subunit alpha
  KO
K05059  ciliary neurotrophic factor receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100455669 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100455669 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100455669 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100455669 (CNTFR)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100455669 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Receptors
  100455669 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_5
Other DBs
NCBI-GeneID: 100455669
NCBI-ProteinID: XP_024108449
LinkDB
Position
9
AA seq 372 aa
MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLRGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSVPITLAL
AAAAATASSLLI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgctcctgtcccgtgggcctgctgtgccgtgcttgctgccgccgccgcagttgtc
tacgcccagagacacagtccacaggaggcaccccatgtgcagtacgagcgcctgggctct
gacgtgacactgccatgtgggacagcaaactgggatgctgcagtgacgtggcgggtaaat
gggacagacctggcccctgacctgctcaacggctctcagctggtactccgtggcctggaa
ctgggccacagtggcctctacgcctgcttccatcgtgactcctggcacctgcgccaccaa
gtcctgctgcatgtgggcttgccgccgcgggagcctgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcatctgcccacccccacctacattcccaacacc
ttcaatgtgactgtgctgcatggctccaaaattatggtctgtgagaaggacccagccctc
aagaaccgctgccacattcgctacatgcacctgttctccaccatcaagtacaaggtctcc
ataagtgtcagcaatgccctgggccacaatgccacagctatcacctttgacgagttcacc
attgtgaagcctgatcctccagaaaatgtggtagcccggccagtgcccagcaaccctcgc
cggctggaggtgacgtggcagaccccctcgacctggcctgaccctgagtcttttcctctc
aagttctttctgcgctaccgacccctcatcctggaccagtggcagcatgtggagctgtcc
gacggcacagcacacaccatcacagatgcctacgccgggaaggagtacattatccaggtg
gcagccaaggacaatgagatcgggacgtggagtgactggagcgtggccgcccacgctacg
ccctggactgaggaaccgcgacacctcaccacagaggcccaggctgcggagaccacgacc
agcaccaccagttccctggcacccccgcctaccacgaagatctgtgaccctggggagctg
ggcagcggcgggggaccctcggcacccttcttggtcagcgtccccatcactctggccctg
gctgctgctgccgccactgccagcagtctcttgatctga

KEGG   Pongo abelii (Sumatran orangutan): 100455762
Entry
100455762         CDS       T01416                                 

Gene name
IL20RA
Definition
(RefSeq) interleukin-20 receptor subunit alpha isoform X1
  KO
K05136  interleukin 20 receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100455762 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100455762 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100455762 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100455762 (IL20RA)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL10/28 receptor family
   100455762 (IL20RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 100455762
NCBI-ProteinID: XP_002817448
Ensembl: ENSPPYG00000017037
UniProt: H2PKF3 A0A6D2XCA2
LinkDB
Position
6
AA seq 553 aa
MPAPGRPASRPPLLPPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWTPPE
GLQGVEVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKC
SKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDFPVSMQQIYSNLK
YNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCIHVESFVPGPPRRAQPSEKQCARTL
KDQSSEFKAKIIFWYVLPVSVTVFLFSVMGYSIYRYIHVGKEKHPENLILIYGNEFDKRF
FVPAEKIVINFITLNISDDSKISHQDMSLLGQSSDVSSLNDPQPSGNLRPPQEEEEVKHL
GYASHLMEFFCDSEENTEGTSLTQQESLSRTIPPDKTVIEYEYDVRTTDICAGPEEQELS
LQEEVSTQGTLLELQAASAILGPQMLQYSCTPQLQDLDPLAQEHTDSEEGPEEEPSMTLV
DWDPQTGRLCIPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEPAPDRPPGENETYLMQ
FMEEWGLYVQMEN
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgccggctcccggccgcccggcctcgcggccgccgctgctgccgccgctgctgctcctg
ctcctggcggcgccttggggacgggcagttccctgtgtctctggtggtttgcctaaacct
gcaaacatcaccttcttatccatcaacatgaagaatgtcctacaatggactccaccagag
ggtcttcaaggagttgaagttacttacactgtgcagtatttcatatatgggcaaaagaaa
tggctgaataaatcagaatgcagaaatatcaatagaacctactgtgatctttctgctgaa
acttctgactacgaacaccagtattatgccaaagttaaggccatttggggaacaaagtgt
tccaaatgggctgaaagtggacggttctatccttttttagaaacacaaattggcccacca
gaagtggcactgactacagatgagaagtccatttctgttgtcctgacagctccagagaag
tggaagagaaatccggaagactttcctgtttccatgcaacaaatatactccaatctgaag
tataatgtgtctgtgttgaatactaaatcaaacagaacgtggtcccagtgtgtgaccaac
cacacgctggtgctcacctggctggagccgaacactctttactgcatccacgtggagtcc
ttcgtcccagggccccctcgccgtgctcagccttctgagaagcagtgtgccaggactttg
aaagatcaatcatcagagttcaaggctaaaatcatcttctggtatgttttgcccgtatct
gttaccgtgtttcttttttctgtgatgggctattccatctaccgatatatccacgttggc
aaagagaaacacccagaaaatttgattttgatttatggaaatgaatttgacaaaagattc
tttgtgcctgctgaaaaaatcgtgattaactttatcaccctcaatatctcggatgattct
aaaatttctcatcaggatatgagtttactgggacaaagcagtgatgtatccagccttaat
gatcctcagcccagcgggaacctgaggccccctcaggaggaagaggaggtgaaacattta
gggtatgcttcccatttgatggaatttttttgtgactctgaagaaaacacagaaggtact
tccctcacccagcaagagtccctcagcagaacaatacccccagataaaacagtcattgaa
tatgaatatgatgtcagaaccactgacatttgtgcggggcctgaagagcaggagctcagt
ttgcaggaggaggtgtccacgcaaggaacattattggagttgcaggcagcgtcggcaatc
ttgggcccgcaaatgttacagtactcatgcacccctcagctccaagacttagaccccctg
gcacaggagcacacagactcagaggaggggccagaggaagagccatcgatgaccctggtc
gactgggacccccaaactggcaggctgtgtattccttcgctgtccagcttcgaccaggat
tcagagggctgcgagccttctgagggggatgggctcggggaggagggtcttctgtctaga
ctctatgaggagccggctccagacaggccaccaggagaaaatgaaacctacctcatgcaa
ttcatggaggaatgggggttatatgtgcagatggaaaactga

KEGG   Pongo abelii (Sumatran orangutan): 100456367
Entry
100456367         CDS       T01416                                 

Gene name
IL22RA2
Definition
(RefSeq) interleukin-22 receptor subunit alpha-2 isoform X1
  KO
K05139  interleukin 22 receptor alpha 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100456367 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100456367 (IL22RA2)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL10/28 receptor family
   100456367 (IL22RA2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind Receptor_2B4
Other DBs
NCBI-GeneID: 100456367
NCBI-ProteinID: XP_002817450
Ensembl: ENSPPYG00000017038
UniProt: A0A2J8X9L8
LinkDB
Position
6
AA seq 263 aa
MMPKHCFLGFLISFFLTGVAGTQPTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVY
FVQYKIMFSYSMKSSHQKPSGCWQHTSCNFPGCRTWAKYGQRQWKNKEDCWGTQELFCDL
TSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPGMNITQVNGSLLVILHA
PNLPYRYQKEKNISIEDYYELLYRVFIINNSLEKEQKVYEGAHRVVEIEALTPHSSYCVV
AETYQPILDRRSQRSEERCVEIP
NT seq 792 nt   +upstreamnt  +downstreamnt
atgatgcctaaacattgctttctaggcttcctcatcagtttcttccttactggtgtagca
ggaactcagccaacacatgagtctctgaaacctcagagggtacaatttcagtcccgaaat
tttcacaacattttgcaatggcagcctgggagggcacttactggcaacagcagtgtctat
tttgtgcagtacaaaatcatgttctcatacagcatgaaaagctctcaccagaagccaagt
ggatgctggcagcacacttcttgtaacttcccaggctgcagaacatgggctaaatatgga
cagagacaatggaaaaataaagaagactgttggggtactcaagaactcttttgtgacctt
accagtgaaacctcagacatacaggaaccttattacgggagggtgagggcggcctcggct
gggagctactcagaatggagcatgacgccgcggttcactccctggtgggaaacaaaaata
gatcctccaggcatgaatataacccaggtcaatggatctttgttggtaattctccatgct
ccaaatttaccgtatagataccaaaaggaaaaaaatatatctatagaagattactatgaa
ctactataccgagtttttataattaacaactcactagaaaaggagcaaaaggtttatgaa
ggggctcacagagtggttgaaattgaagctctaacaccacactccagctactgcgtagtg
gctgaaacgtatcagcccatattagacagaagaagtcagagaagcgaagagagatgtgtg
gaaattccatga

KEGG   Pongo abelii (Sumatran orangutan): 100456779
Entry
100456779         CDS       T01416                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin-12 receptor subunit beta-2 isoform X1
  KO
K05064  interleukin 12 receptor beta-2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon05200  Pathways in cancer
pon05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100456779 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100456779 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100456779 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100456779 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100456779 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100456779 (IL12RB2)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100456779 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind Tissue_fac EpoR_lig-bind
Other DBs
NCBI-GeneID: 100456779
NCBI-ProteinID: XP_024101126
Ensembl: ENSPPYG00000001257
LinkDB
Position
1
AA seq 862 aa
MAHTFRGCSLALIFIITWLLIKAKIDACKRGDVTVKPSRVILLGSTVNISCSLKPRQGCL
HYSRRNKLILYKFDRRINFHHGHSLNSQVTDLPLGTTLFVCKLACINSDEIQICGAEIFV
GVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDTYCDY
LDFGINLTPESPESSFTAKVTAVNSLGSSSSFPSTFTFLDIVRPLPPWDIRIKFQKASVS
RCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHL
YKGSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHY
QVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAG
LLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSPPYN
VSALISENIKSYICYEIHVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILIS
WNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTA
LTAAGESSHGNEREFCLQGKANWMAFVAPSICIAIIMVGIFSTHYFQQKVFVLLAALRPQ
WCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVFRR
PHCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALPAESRQLVDLYKVLESRGSDPKPE
NPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPL
TFSCGDKLTLDQLKMRRDSLML
NT seq 2589 nt   +upstreamnt  +downstreamnt
atggcacatacttttagaggatgctcattggcacttatttttataatcacgtggctgttg
attaaagcaaaaatagatgcgtgcaagagaggcgatgtgactgtgaagccttcccgtgta
attttacttggatccactgtcaatatttcatgctctttgaagcccagacaaggctgcttg
cactattccagacgtaacaagttaatcctatacaagtttgacagaagaatcaattttcac
catggccactccctcaattctcaagtcacagatcttccccttggtacaaccttgtttgtc
tgcaaactggcctgtatcaatagtgatgaaattcaaatatgtggagcagagatcttcgtt
ggtgttgctccagaacagcctcaaaatttatcctgcatacagaagggagaacaggggact
gtggcctgcacctgggaaagaggacgagacacccacttatacactgagtatactctacag
ctaagtggaccaaaaaatttaacctggcagaagcaatgtaaagacacttattgtgactat
ttggactttggaatcaacctcacccctgaatcacctgaatccagtttcacagccaaggtt
actgctgtcaatagtcttggaagctcctcttcatttccatccacattcacattcttggac
atagtgaggcctcttcctccgtgggacattagaatcaaatttcaaaaggcttccgtgagc
agatgtaccctttattggagagatgagggactggtactgcttaatcgactcagatatcgg
cccagtaacagcaggctctggaatatggttaatgttacaaaggccaaaggaagacatgat
ttgctggatctgaaaccatttacagaatatgaatttcagatttcctctaagctacatctt
tataagggaagttggagtgattggagtgaatcactgagagcacaaacaccagaagaagag
cctactgggatgttagatgtctggtacatgaaacggcacattgactacagtagacaacag
atttctcttttctggaagaatctcagtgtctcagaggcaagaggaaaaattctccactat
caggtgaccttgcaggagctgacaggagggaaagccatgacacagaacatcacaggacac
acctcctggaccacagtcattcctagaaccggaaattgggctgtggctgtgtctgcagca
aattcaaaaggcagttctctgcccactcgtattaacataatgaacctgtgtgaggcaggg
ttgctggctcctcgccaggtctctgcaaactcagagggcatggacaacattctggtgact
tggcagcctcccaggaaagatccctctgctgttcaggagtacgtggtggaatggagagag
ctccatccagggggtgatacacaagtccctctaaactggctacggagtccgccctacaat
gtgtctgctctgatttcagagaacataaaatcttacatctgttatgaaatccatgtgtat
gcactctcaggggatcaaggaggatgcagctccatcctgggtaactctaagcacaaagca
ccactgagtggcccccacattaatgccatcacagaggaaaaggggagcattttaatttca
tggaacagcattccagtccaggagcaaatgggctgcctcctccattacaggatatactgg
aaggaacgggactccaactcccagcctcagctctgtgaaattccttatagagtctcccaa
aattcacatccaataaacagcctgcagccccgagtgacatatgtcctgtggatgacagct
ctgacagctgctggcgaaagttcccacggaaatgagagggaattttgtctgcaaggtaaa
gccaattggatggcgtttgtggcaccaagcatttgcattgctatcatcatggtgggcatt
ttctcaacgcattacttccagcaaaaggtgtttgttctcctagcagccctcagacctcag
tggtgtagcagagaaattccagatccagcaaatagcacttgcgctaagaaatatcccatt
gcagaggagaagacacagctgcccttggacaggctcctgatagactggcccacgcctgaa
gatcctgaaccgctggtcatcagtgaagtccttcatcaagtgaccccagttttcagacgt
ccccactgctccaactggccacaaagggaaaaaggaatccaaggtcatcaggcctctgag
aaagacatgatgcacagtgcctcaagcccaccacctccaagagctctcccagctgagagc
agacaactggtggatctgtacaaggtgctggagagcaggggctccgacccaaagccagaa
aacccagcctgtccctggacggtgctcccagcaggtgaccttcccacccacgatggctac
ttaccctccaacatagatgacctcccctcacatgaggcgcctctcgctgactctctggaa
gaactggagcctcagcacatctccctttctgttttcccctcaagttctcttcacccactc
accttctcctgtggtgataagctgactctggatcagttaaagatgaggcgtgactccctc
atgctctga

KEGG   Pongo abelii (Sumatran orangutan): 100457063
Entry
100457063         CDS       T01416                                 

Gene name
CSF2RB
Definition
(RefSeq) cytokine receptor common subunit beta
  KO
K04738  cytokine receptor common subunit beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04210  Apoptosis
pon04630  JAK-STAT signaling pathway
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100457063 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100457063 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100457063 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100457063 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100457063 (CSF2RB)
   04090 CD molecules [BR:pon04090]
    100457063 (CSF2RB)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL3 receptor family
   100457063 (CSF2RB)
CD molecules [BR:pon04090]
 Proteins
  100457063 (CSF2RB)
SSDB
Motif
Pfam: fn3 IL4Ra_N IL6Ra-bind Tissue_fac EpoR_lig-bind IL2RB_N1 Interfer-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 100457063
NCBI-ProteinID: XP_024095993
Ensembl: ENSPPYG00000011780
LinkDB
Position
22
AA seq 892 aa
MALAQGLLSMALLALCWGRSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVT
LIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLG
TRLTVTLSHHVQPPAPRDLQISTDQDHFLLTWSVALGSPQSHWLSQGDLEFEVVYKRLQD
SWEDAATLLSNTSQAALRPEHLMPSSTYVARVRTRLAPGSRLSGHPSKWSPEVRWDSQPG
DEAQPQNLQCFFDGATVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSL
HTRHHCQIPVPDPTTHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWET
MKMQYEHIDHTFEIQYRKDTATWKDSKTETLRNAHSMALPALEPSTRYWARVRVRTSRTG
YNGIWSEWSEACSWDTESVLPLWVLALVVIFLTIAVLLALRFCGIYGYRLRRKWEEKIPN
PSKSHLFQNGSAEIWPPGSMSAFTSGSPPHQGPWGSRFPELEGVFPVGFEDSEVSPLTIE
DPKHVCDPPSGPDTTPAASDLPTEQPPSPQPGPPAPSHTPEKQVSSFDFNGPYLGPPHSH
SLPDILGQPEPPQEGGSQKSPPPGSLEYMCLPAGGQVQLVPLAQAMGPGQAVEVERRPSQ
GAAGSPSLESGGGPAPPALGPRVGGQDQKDSPVAIPTEDPGAASGYVSSADLVFTPHSGA
SSVSLVPSLGLPSDQTPSLCPGLASGPPGAPGPVKSGFEGYVELPPIEGQSPRSPRNNPV
PPEARSPVLNPGERRAGVSPTSPQPEGLLVLQQVGDYCFLPGLGPSPLSLRSKPSSPGPC
PEIRDLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC
NT seq 2679 nt   +upstreamnt  +downstreamnt
atggcgctggcccaggggctgctctccatggccctgctggccctgtgctgggggcgcagc
ctggcaggggcagaagaaaccatcccgctgcagaccctgcgctgctacaacgactacacc
agccacatcacctgcaggtgggcagacacccaggatgcccagcggctcgtcaacgtgacc
ctcattcgccgggtgaatgaggaccttctggagccggtgtcctgtgacctcagtgatgac
atgccctggtcagcctgcccccatccccgctgcgtgcccaggagatgtgtcattccctgc
cagagttttgtcgtcactgatgttgactacttctcattccaaccagacaggcctctgggc
acccggctcaccgtcactctgtcccatcatgtccagcctcctgcgcccagggacctgcag
atcagcactgaccaggaccacttcctgctgacctggagtgtggcccttgggagtccccag
agccattggttgtcccagggggatctggagtttgaggtggtctacaagcggcttcaggac
tcttgggaggatgcagccaccctcctctccaacacctcccaggccgccctgaggccagag
cacctcatgcccagcagcacctacgtggcccgagtacggacccgcctggccccaggctct
cggctctcaggacatcccagcaaatggagcccagaggttcgctgggactcccagccaggg
gacgaggcccagccccagaacctgcagtgcttctttgacggggccaccgtcctcagctgc
tcctgggaggtgaggaaggaggtggccagctctgtctcctttggcctcttctacaagccc
agcccagatgcaggggaggaagagtgctccccagtgctgagggaggggctcggcagcctc
cacaccaggcaccactgccagattcccgtgcccgaccccacgacccacggccagtacatc
gtctctgttcagccaaggagagcagagaaacacataaagagctcagtgaacatccagatg
gcccctccatccctcaacgtgaccaaggatggagacagctacagcctgcgctgggaaaca
atgaaaatgcaatacgaacacatagaccacacatttgagatccagtacaggaaagacacg
gccacgtggaaggacagcaagactgagaccctccggaatgcccacagcatggccctgcca
gccctggagccctccaccaggtactgggccagggtgagggtcaggacctcccgcaccggc
tacaacgggatctggagcgagtggagtgaggcgtgctcctgggacactgagtcggtgctt
cctctgtgggtgctggccctcgtcgtgatcttcctcaccatcgctgtgctcctggccctc
cgcttctgtggcatctacgggtacaggctgcgcagaaagtgggaggagaagatccccaac
cccagcaagagccacctgttccagaatgggagcgcagagatttggcccccaggcagcatg
tcggccttcaccagcgggagccccccacaccaggggccgtggggcagccgcttccctgag
ctggagggggtgttccctgtaggatttgaggacagcgaggtgtcacctctcaccatagag
gatcccaagcatgtctgtgatccaccatctgggcctgacacgactccagctgcctcagat
ctgcccacagagcagccccccagcccccagccaggcccacctgccccctcccacacacct
gagaaacaggtttccagctttgacttcaatgggccctacctggggccaccccacagccac
tccctgcctgacatcctgggccagccggagcccccacaggagggtgggagccagaagtcc
ccacctccagggtccctggagtacatgtgtctgcctgctggggggcaggtgcaactggtc
cctctggcccaggcgatgggaccgggccaggccgtggaagtggagaggaggccgagccag
ggggctgcagggagcccctccctggagtctgggggaggccctgcccctcctgctcttggg
ccaagggtgggaggacaggaccaaaaggacagccctgtggctatacccaccgaggaccct
ggagcggcctctggttatgtctcctctgcagacctggtattcaccccacactcaggggct
tcgtctgtctccctagttccctctctgggcctcccctcagaccagacccccagcttatgt
cctgggctggccagtggaccccctggagccccaggccctgtgaagtcagggtttgagggc
tatgtggagctccctccaattgagggccagtcccccaggtccccaaggaacaatcctgtc
ccccctgaggccagaagccctgtcctgaacccaggggaacgccgggcaggtgtgtcccca
acatccccacagcccgagggcctccttgtcctgcagcaagtgggcgactattgcttcctc
cccggcctggggcccagccctctctcactccggagtaaaccttcttccccaggaccctgt
cctgagatcagggacctagaccaagcttttcaagtcaagaagcccccaggccaggctgtg
ccccaggtgcccgtcattcagctcttcaaagccctgaagcagcaggactacctctctctg
cccccttgggaggtcaacaagcctggggaggtgtgttga

KEGG   Pongo abelii (Sumatran orangutan): 100457694
Entry
100457694         CDS       T01416                                 

Gene name
IL13RA1
Definition
(RefSeq) interleukin-13 receptor subunit alpha-1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100457694 (IL13RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100457694 (IL13RA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100457694 (IL13RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100457694 (IL13RA1)
   04090 CD molecules [BR:pon04090]
    100457694 (IL13RA1)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL3 receptor family
   100457694 (IL13RA1)
CD molecules [BR:pon04090]
 Proteins
  100457694 (IL13RA1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 EpoR_lig-bind Tissue_fac LIFR_D2 LIFR_N
Other DBs
NCBI-GeneID: 100457694
NCBI-ProteinID: XP_024096507
Ensembl: ENSPPYG00000020661
LinkDB
Position
X
AA seq 425 aa
MEWPARLCGLWALLLCAGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASPNC
SLWYFSHFGDKQDKKIAPETRRSKEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPE
GDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIYREGQY
FGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDD
LYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEAKCQNPEFERNVENTSCFMVPGV
LPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNSTLYITMLLIVPVIVAGAIIV
LLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIENL
KKASQ
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggagtggccggcgcggctctgcgggctgtgggcgctgctgctctgtgccggcggcggg
ggcgggggcgccgcgcctacggaaactcagccacctgtgacaaatttgagtgtctctgtt
gaaaatctctgcacagtaatatggacatggaatccacctgagggagccagcccaaattgt
agtctatggtattttagtcattttggcgacaaacaagataagaaaatagctccggaaact
cgtcgttcaaaagaagtgcccctgaatgagaggatttgtctgcaagtggggtcccagtgt
agcaccaatgaaagtgagaagcctagcattttggttgaaaaatgcatctcacccccagaa
ggtgatcctgagtctgctgtgactgagcttcaatgcatttggcacaacctgagctacatg
aagtgttcttggctgcctggaaggaataccagtcccgacactaactatactctctactat
tggcacagaagcctggaaaaaattcatcaatgtgaaaacatctatagagaaggccaatac
tttggttgttcctttgatctaactaaagtgaaggattccagttttgaacaacacagtgtc
caaataatggtcaaggataatgcaggaaaaattaaaccatccttcaatatagtgccttta
acttcccgtgtgaaacctgatcctccacatattaaaaacctctccttccacaatgatgac
ctatatgtgcaatgggagaatccacagaattttattagtagatgcctattttatgaagta
gaagtcaataacagccaaactgagacacataatgttttctacgtccaagaggctaaatgt
cagaatccagaatttgagagaaatgtggagaatacatcttgtttcatggtccctggtgtt
cttcctgatactttgaacacagtcagaataagagtcaaaacaaataagttatgctatgag
gatgacaaactctggagtaattggagccaagaaatgagtataggtaagaagcgcaattcc
acactctacataaccatgttactcattgttccagtcatcgtcgcaggtgcaatcatagta
cttctgctttacctaaaaaggctcaagattattatattccctccaattcctgatcctggc
aagatttttaaagaaatgtttggagaccagaatgatgatactctgcactggaagaagtac
gacatctatgagaagcaaaccaaggaggaaaccgactctgtagtgctgatagaaaacctg
aagaaagcctctcagtga

KEGG   Pongo abelii (Sumatran orangutan): 100458031
Entry
100458031         CDS       T01416                                 

Gene name
IL20RB
Definition
(RefSeq) interleukin-20 receptor subunit beta isoform X1
  KO
K05137  interleukin 20 receptor beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100458031 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100458031 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100458031 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100458031 (IL20RB)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL10/28 receptor family
   100458031 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 100458031
NCBI-ProteinID: XP_024100466
LinkDB
Position
3
AA seq 311 aa
MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIVP
GETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPGCDVTDDITATVPYNLRVRATLGSQ
TSAWSILKHPFNRNSTILTPPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHV
KMVRSGGIPVHLETMEPGAAYCVKAQTLVKAIGRYSAFSQTECVEVQGEAIPLVLALFAF
VGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVM
SPEELLRAWIS
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcagactttcacaatggttctagaagaaatctggacaagtcttttcatgtggtttttc
tacgcattgattccatgtttgctcacagatgaagtggccattctgcctgcccctcagaac
ctctctgtactctcaaccaacatgaagcatctcttgatgtggagcccagtgatcgtgcct
ggagaaacagtgtactattctgtcgaataccagggggagtacgagagcctgtacacgagc
cacatctggatccccagcagctggtgctcactcactgaaggtcctgggtgtgatgtcact
gatgacatcacagccactgtgccatacaaccttcgtgtcagggccacactgggctcacag
acctcagcctggagcatcctgaagcatccctttaatagaaactcaaccatccttacccca
cctgggatggagatcaccaaagatggcttccacctggttattgagctggaggacctgggg
ccccagtttgagttccttgtggcctactggaggagggagcctggtgccgaggaacatgtc
aaaatggtgaggagtgggggtattccagtgcacctagaaaccatggagccaggagctgca
tactgtgtgaaggcccagacattagtgaaggccattgggaggtacagcgccttcagccag
acagaatgtgtggaggtgcaaggagaggccattcccctggtactggccctgtttgccttt
gttggcttcatgctgatccttgtggtcgtgccactgttcgtctggaaaatgggccggctg
ctccagtactcctgttgccccgtggtggtcctcccagacaccttgaaaataaccaattca
ccccagaagttaatcagctgcagaagggaggaggtggatgcctgtgccacggctgtgatg
tctcctgaggaactcctcagggcctggatctcatag

KEGG   Pongo abelii (Sumatran orangutan): 100458963
Entry
100458963         CDS       T01416                                 

Gene name
IL23R
Definition
(RefSeq) interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04659  Th17 cell differentiation
pon05200  Pathways in cancer
pon05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100458963 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100458963 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100458963 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458963 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100458963 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100458963 (IL23R)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100458963 (IL23R)
SSDB
Motif
Pfam: IL6Ra-bind IL12p40_C fn3 Lep_receptor_Ig PriX
Other DBs
NCBI-GeneID: 100458963
NCBI-ProteinID: XP_002810764
Ensembl: ENSPPYG00000001258
UniProt: H2N740 A0A6D2X135
LinkDB
Position
1
AA seq 629 aa
MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDIS
SGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYIN
ISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSASIISRAETINATVPKTII
YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETG
KRYWQPWSSPFFHKTPETVPQVTSKSFQHDTWNSGLTVVSISTGHLTSDNREDIGLLLGM
IVFAVMLSILSLIGIFNRSLRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMN
NNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENTGPLETRDYLQNSLFDNTTVVYIPDL
NTGYKPQISNFLPGGSHLSNNNEITSLTLKSPVDSLDSGNNPRLQKHPNFAFSVSSVNSL
SNTLFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPNETIPEQTLLPDEFVSCLGI
VNEELPSINTYFPQNILESHFNRISLLEK
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgaatcaggtcactattcaatgggatgcagtaatagccctttacatactcttcagctgg
tgtcatggaggaattacaaatataaactgctctggccacatctgggtagaaccagccaca
atttttaagatgggtatgaatatctctatatattgccaagcagcaattaagaactgccaa
ccaaggaaacttcatttttataaaaatggcatcaaagaaagatttcaaatcacaaggatt
aataaaacaacagctcggctttggtataaaaactttctggaaccacatgcttctatgtac
tgcactgctgaatgtcccaaacattttcaagagacactgatatgtggaaaagacatttct
tctggatatccgccagatattcctgatgaggtaacctgtgtcatttatgaatattcaggc
aacatgacttgcacctggaatgctgggaagctcacctacatagacacaaaatacgtggtg
catgtgaagagtttagagacagaagaagagcaacagtatctcacctcaagctatattaac
atctccactgattcattacaaggtggcaagaagtacttggtttgggtccaagcagcaaac
gcactaggcatggaagagtcaaaacaactgcaaattcacctggatgatatagtgatacct
tctgcatccatcatttccagagctgagactataaatgctacggtgcccaagaccataatt
tattgggatagtcaaacaacaattgaaaaggtttcctgtgaaatgagatacaaggctaca
acaaaccaaacttggaatgttaaagaatttgacaccaattttacatatgtgcaacagtca
gaattctacttggagccaaacattaagtacgtatttcaagtgagatgtcaagaaacaggc
aaaaggtactggcagccttggagttctccgttttttcataaaacacctgaaacagttccc
caggtcacatcaaaatcattccaacatgacacatggaattctgggctaacagttgtttcc
atctctacaggacaccttacttctgacaacagagaagacattggacttttattgggaatg
atcgtctttgctgttatgttgtcaattctttctttgattgggatatttaacagatcactc
cgaactgggattaaaagaaggatcttattgttaataccaaagtggctttatgaagatatt
cctaatatgaaaaacagcaatgttgtgaaaatgctacaggaaaatagtgaacttatgaat
aataattccagtgagcaggtcctatatgttgatcccatgattacagagataaaagaaatc
tttatcccagaacacaagcctacagactacaagaaggagaataccggacccctggagaca
agagactacctacaaaactcgctattcgacaatactacagttgtatatattcctgatctc
aacactggatataaaccccaaatttcaaattttctgcctggaggaagccatctcagcaat
aataatgaaattacttccttaacacttaaatcaccagttgattccttagactcaggaaat
aatcccaggttacaaaagcatcctaattttgctttttctgtttcaagtgtgaattcacta
agcaacacactatttcttggagaattaagcctcatattaaatcaaggagaatgcagttct
cctgacatacaaaactcagtagaggaggaaaccaccatgcttttggaaaacgattcaccc
aatgaaactattccagaacagaccctgcttcctgatgaatttgtctcctgtttggggatc
gtgaatgaggagttgccatctattaatacttattttccacaaaatattttggaaagccac
ttcaataggatttcactcttggaaaagtag

KEGG   Pongo abelii (Sumatran orangutan): 100459280
Entry
100459280         CDS       T01416                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X2
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon05160  Hepatitis C
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459280 (EGFR)
   04012 ErbB signaling pathway
    100459280 (EGFR)
   04014 Ras signaling pathway
    100459280 (EGFR)
   04015 Rap1 signaling pathway
    100459280 (EGFR)
   04630 JAK-STAT signaling pathway
    100459280 (EGFR)
   04066 HIF-1 signaling pathway
    100459280 (EGFR)
   04068 FoxO signaling pathway
    100459280 (EGFR)
   04020 Calcium signaling pathway
    100459280 (EGFR)
   04072 Phospholipase D signaling pathway
    100459280 (EGFR)
   04151 PI3K-Akt signaling pathway
    100459280 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100459280 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100459280 (EGFR)
   04520 Adherens junction
    100459280 (EGFR)
   04540 Gap junction
    100459280 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459280 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100459280 (EGFR)
   04915 Estrogen signaling pathway
    100459280 (EGFR)
   04921 Oxytocin signaling pathway
    100459280 (EGFR)
   04926 Relaxin signaling pathway
    100459280 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100459280 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459280 (EGFR)
   05206 MicroRNAs in cancer
    100459280 (EGFR)
   05205 Proteoglycans in cancer
    100459280 (EGFR)
   05230 Central carbon metabolism in cancer
    100459280 (EGFR)
   05231 Choline metabolism in cancer
    100459280 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100459280 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100459280 (EGFR)
   05212 Pancreatic cancer
    100459280 (EGFR)
   05225 Hepatocellular carcinoma
    100459280 (EGFR)
   05226 Gastric cancer
    100459280 (EGFR)
   05214 Glioma
    100459280 (EGFR)
   05218 Melanoma
    100459280 (EGFR)
   05219 Bladder cancer
    100459280 (EGFR)
   05215 Prostate cancer
    100459280 (EGFR)
   05213 Endometrial cancer
    100459280 (EGFR)
   05224 Breast cancer
    100459280 (EGFR)
   05223 Non-small cell lung cancer
    100459280 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100459280 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100459280 (EGFR)
   05171 Coronavirus disease - COVID-19
    100459280 (EGFR)
   05163 Human cytomegalovirus infection
    100459280 (EGFR)
   05165 Human papillomavirus infection
    100459280 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100459280 (EGFR)
   01522 Endocrine resistance
    100459280 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100459280 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100459280 (EGFR)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100459280 (EGFR)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100459280 (EGFR)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100459280 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100459280 (EGFR)
  Exosomal proteins of bladder cancer cells
   100459280 (EGFR)
SSDB
Motif
Pfam: Recep_L_domain GF_recep_IV Furin-like
Other DBs
NCBI-GeneID: 100459280
NCBI-ProteinID: XP_002817983
LinkDB
Position
7
AA seq 628 aa
MRSSRTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGS
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgcgatcctcccggacggccggggcagcgctcctggcgctgctagctgcgctctgcccg
gcgagtcgggctctggaggaaaagaaagtttgccaaggcacgagtaacaagctcacgcag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatctggaaattacctatgtacagaggaattatgatctttccttcttaaag
accatccaggaggtggctggttatgtcctcatcgccctcaacacagtggagcggattcct
ttggaaaacctgcagatcatcagaggaaatatgtactatgaaaattcctatgccttagca
gtcttatctaactatgatgcaaataaaaccggactaaaggagctgcccatgagaaattta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagcgactttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaagctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctct
gggcgctgccgcggcaaatcccccagtgactgctgccacaaccagtgtgccgctggctgc
acgggcccccgggagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctctacaaccccaccacataccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgtggggccgacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaacggaata
ggtattggtgaatttaaagacacactctccataaatgctacgaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacacactccacctctggatccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggacctccatgctttt
gagaacctagaaatcatacgcggcaggaccaagcaacatgggcagttttctcttgcagtc
gtcagcctgaacataacatccttgggattacgctccctcaaggagataagcgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccggtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacaggccaggtctgccatgccttgtgctcccccgagggctgctggggcccggagccc
agggactgcgtctcctgccggaatgtcagccgaggcagagaatgcgtggacaagtgcaac
attctggagggcgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gaatgcctgccccaggccatgaacatcacctgcacgggacggggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccggcaggagtcatg
ggagaaaacaacaccctggtctggaagtacgcagacgccggccacgtgtgccacctgtgc
catccaaactgcacctacgggtcctaa

KEGG   Pongo abelii (Sumatran orangutan): 100459702
Entry
100459702         CDS       T01416                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04659  Th17 cell differentiation
pon04932  Non-alcoholic fatty liver disease
pon05163  Human cytomegalovirus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100459702 (IL6R)
   04066 HIF-1 signaling pathway
    100459702 (IL6R)
   04151 PI3K-Akt signaling pathway
    100459702 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100459702 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100459702 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100459702 (IL6R)
   04659 Th17 cell differentiation
    100459702 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459702 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100459702 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100459702 (IL6R)
   05163 Human cytomegalovirus infection
    100459702 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100459702 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100459702 (IL6R)
   04090 CD molecules [BR:pon04090]
    100459702 (IL6R)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100459702 (IL6R)
CD molecules [BR:pon04090]
 Proteins
  100459702 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind ig Ig_3 Ig_2 fn3 I-set Ig_5
Other DBs
NCBI-GeneID: 100459702
NCBI-ProteinID: XP_024090051
Ensembl: ENSPPYG00000000781
LinkDB
Position
1
AA seq 484 aa
MLAVGCALLAALLAAPGEALAPGRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHSSRWAGMGRRLLLRSVQLHDSGNYSCYQAGRPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSWESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTGFSPQTIPGGIWDPAGESRSPPAENEVSTPMQALTTNKDDDNIL
VRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCVAIVLRFKKTWKLRALKEGKTSI
HPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDY
FFPR
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgctggccgtcggctgcgcgctgctggctgccctgctcgccgcgccgggagaggcgctg
gccccagggcgctgccctgcgcaggaggtggcgagaggtgtgctgaccagtctgccagga
gacagcgtgactctgacctgcccaggggtagagccggaagacaatgccactgttcactgg
gtgctcaggaagccggctgcaggctcccattctagcagatgggctggcatgggaaggagg
ctgctgctgaggtcggtgcagctccatgactctggaaactattcatgctaccaggccggc
cgcccagctgggactgtgcacttgctggtggatgttccccccgaggagccccagctctcc
tgcttccggaagagccccctcagcaacgttgtttgtgagtggggtcctcggagcacccca
tccctgacgaccaaggctgtgctgttggtgaggaagtttcagaacagtccggccgaagac
ttccaggagccgtgccagtattcctgggagtcccagaagttctcctgccagttggcagtc
ccggagggagacagctctttctacatagtgtccatgtgcgttgccagtagtgtcgggagc
aagttcagcaaaactcaaacctttcagggttgtggaatcttgcagcctgatccgcctgcc
aacatcacagtcactgccgtggccagaaacccccgctggctcagtgtcacctggcaagac
ccccactcctggaactcatctttctacagactacggtttgagctcagatatcgggctgaa
cggtcaaagacattcacaacatggatggtcaaggacctccagcatcactgtgtcatccac
gacgcctggagcggcctgaggcacgtggtgcagcttcgtgcccaggaggagttcgggcaa
ggcgagtggagcgagtggagcccggaggccatgggcacaccttggacaggcttctctcca
cagaccatcccgggtggcatttgggacccagctggagaatccaggagtcctccagctgag
aacgaggtgtccacccccatgcaggcacttactactaataaagacgatgataatattctc
gtcagagattctgcaaatgcgacaagcctcccagtgcaagattcttcttcggtaccactg
cccacattcctggttgctggagggagcctggccttcggaacgctcctctgcgttgccatt
gttctgaggttcaagaagacgtggaagctgcgggctctgaaggaaggcaagacaagcata
cacccgccgtactctttggggcagctggtcccggagaggcctcgacccaccccagtgctt
gttcctctcatctccccaccggtgtcccccagcagcctggggtctgacaatacctcgagc
cacaaccgaccagatgccagggacccacggagcccttatgacatcagcaatacagactac
ttcttccccagatag

KEGG   Pongo abelii (Sumatran orangutan): 100460001
Entry
100460001         CDS       T01416                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100460001 (PDGFRB)
   04014 Ras signaling pathway
    100460001 (PDGFRB)
   04015 Rap1 signaling pathway
    100460001 (PDGFRB)
   04630 JAK-STAT signaling pathway
    100460001 (PDGFRB)
   04020 Calcium signaling pathway
    100460001 (PDGFRB)
   04072 Phospholipase D signaling pathway
    100460001 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    100460001 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100460001 (PDGFRB)
   04540 Gap junction
    100460001 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460001 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460001 (PDGFRB)
   05206 MicroRNAs in cancer
    100460001 (PDGFRB)
   05230 Central carbon metabolism in cancer
    100460001 (PDGFRB)
   05231 Choline metabolism in cancer
    100460001 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    100460001 (PDGFRB)
   05218 Melanoma
    100460001 (PDGFRB)
   05215 Prostate cancer
    100460001 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100460001 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100460001 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100460001 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100460001 (PDGFRB)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100460001 (PDGFRB)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100460001 (PDGFRB)
CD molecules [BR:pon04090]
 Proteins
  100460001 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set C1-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 100460001
NCBI-ProteinID: XP_002816120
Ensembl: ENSPPYG00000015943
UniProt: A0A663D6Y7 H2PH25
LinkDB
Position
5
AA seq 1106 aa
MRLLGAMPALALKGQLLLLPLLLLLEPQVSQGLVITPPGPELVLNVSSTFVLTCSGSAPV
VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLEPDERKRLYIFV
PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDIALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQV
EPEPELEQLPDSGCPAPRVEAEDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgcggcttctgggtgcgatgccagctctggccctcaaaggccagctgctgttgctgccc
ctcctgttactgctggaaccacaggtctctcagggcctggtcatcacacccccagggcca
gagcttgtcctcaatgtctccagcaccttcgttctgacctgctctggttcagctccggtg
gtgtgggaacggatgtcccaggagcccccacaggaaatggccaaggcccaggatggcacc
ttctccagcgtgctgacactgaccaacctcactgggctagacacgggagaatacttttgc
acccacaatgactcccgtggactggagcctgatgagcggaaacggctctacatctttgtg
ccagatcccactgtgggcttcctccctaatgatgccgaggaactattcatctttctcacg
gaaataactgagatcaccattccatgccgagtaacagacccacagctggtggtgacactg
cacgagaagaaaggggacattgcactgcctgtcccctatgatcaccaacgtggcttttct
ggtatctttgaggacagaagctacatctgcaaaaccaccattggggacagggaggtggat
tccgatgcctactatgtctacagactccaggtgtcatctatcaacgtctctgtgaacgca
gtgcagactgtggtccgccagggtgagaacatcaccctcatgtgcattgtgatcgggaat
gaggtggtcaacttcgagtggacatacccccgcaaagaaagtgggcggctggtggagccg
gtgaccgacttcctcttggatatgccttaccacatccgctccatcctgcacatccccagt
gccgagttagaagactcggggacctacacctgcaatgtgacggagagtgtgaatgaccat
caggatgaaaaggccatcaacatcaccgtggttgagagtggctacgtgcggctcctggga
gaagtgggcacactgcaatttgctgagctgcatcggagccggacactgcaggtagtattc
gaggcctacccaccgcccaccgtcctgtggtttaaagacaaccgcaccctgggcgactcc
agcgctggcgagatcgccctgtccacgcgcaacgtgtcggagacccggtatgtgtcagag
ctgacactggttcgcgtgaaggtggcagaggctggccactacaccatgcgggccttccat
gaggacgctgaggtccagctctccttccagctacagatcaatgtccctgtccgagtgctg
gagctaagtgagagccaccctgacagcggggaacagacagtccgctgtcgtggccggggc
atgccccagccgaacatcatctggtccgcctgcagagacctcaaaaggtgtccacgcgag
ctgccgcccacgctgctggggaacagttccgaagaggagagccagctggagacgaacgtg
acgtactgggaggaggagcaggagtttgaggtggtgagcacactgcgtctgcagcacgtg
gatcggccgctgtcggtgcgctgcacgctgcgcaacgctgtgggccaggacacgcaggag
gtcatcgtggtgccacactccttgccctttaaggtggtggtgatctcagccatcctggcc
ctggtggtgctcaccatcatctcccttatcatcctcatcatgctttggcagaagaagcca
cgttacgagatccgatggaaggtgattgagtctgtgagctctgacggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacgtgggagctgccgcgggaccagctt
gtgctgggacgcaccctcggctctggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggccacgatgaaagtggccgtcaagatgcttaaatccacagcc
cgcagcagtgagaagcaagcccttatgtcggagctgaagatcatgagtcaccttgggccc
cacctgaacgtggtcaacctgttgggggcctgcaccaaaggaggacccatctatatcatc
actgagtactgccgctacggagacctggtggactacctgcaccgcaacaaacacaccttc
ctgcagcaccactctgacaagcgccgcccgcccagcgcggagctctacagcaatgcactg
cccgttgggctccccctgcccagccatgtgtccttgactggggagagcgacggtggctac
atggacatgagcaaggacgagtcggtggactacgtacccatgctggacatgaaaggagac
gtcaaatatgcagacatcgagtcctccaattacatggccccttacgataactacgttccc
tctgcccctgagaggacctgtcgggcaactttgatcaacgagtctccagtgctaagctac
atggacctcgtgggcttcagctaccaggtggccaatggcatggagtttctggcctccaag
aactgcgtccacagagacctggcggctaggaacgtgctcatctgtgaaggcaagctggtc
aagatctgtgactttggcctggctcgagacatcatgcgggactcgaattacatctccaaa
ggcagcacctttttgcctttgaagtggatggctccggagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcaccttgggt
ggcaccccttacccagagctgcccatgaatgaacagttctacaatgccatcaaacggggt
taccgcatggcccagcctgcccatgcctccgatgagatctatgagatcatgcagaagtgc
tgggaagagaagtttgagattcggccccccttctcccagctggtgctgcttctcgagaga
ctgttgggcgaaggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagt
gaccacccagccatccttcggtcccaggcccgcttgcctgggttccatggcctccgatct
cccctggacaccagctccgtcctctatactgccgtgcagcccaatgagggtgacaacgac
tatatcatccccctgcccgaccccaaacccgaggttgctgacgagggcccactggagggt
tcccccagcctagccagctccaccctgaatgaagtcaacacctcctcaaccatctcctgt
gacagccccctggagccccaggatgaaccagagccagagccccagcttgagctccaggtg
gagccagagccggagctggaacagctgccggattcagggtgccctgcgcctcgggtggaa
gcagaggacagcttcctgtag

KEGG   Pongo abelii (Sumatran orangutan): 100460977
Entry
100460977         CDS       T01416                                 

Gene name
IL2RB
Definition
(RefSeq) interleukin-2 receptor subunit beta isoform X1
  KO
K05069  interleukin 2 receptor beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100460977 (IL2RB)
   04151 PI3K-Akt signaling pathway
    100460977 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100460977 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100460977 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100460977 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100460977 (IL2RB)
   04659 Th17 cell differentiation
    100460977 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460977 (IL2RB)
   05202 Transcriptional misregulation in cancer
    100460977 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100460977 (IL2RB)
   05162 Measles
    100460977 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100460977 (IL2RB)
   04090 CD molecules [BR:pon04090]
    100460977 (IL2RB)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100460977 (IL2RB)
CD molecules [BR:pon04090]
 Proteins
  100460977 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 Pur_ac_phosph_N IL6Ra-bind
Other DBs
NCBI-GeneID: 100460977
NCBI-ProteinID: XP_024095787
LinkDB
Position
22
AA seq 576 aa
MIVSFLRPPQPCGTGFLPRLHPVDVMAASALSWRLPLLILLLPLATPWASAAVNGTSQFT
CFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDS
QKLTAVDIVTLRVMCREGVRWRMMAIQDFKPFENLRLMAPISLRVVHVETHRCNISWEIS
QASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQG
EFTTWSPWSQPLAFRTKPAGLGKDTIPWLGHLLVGLSGAFGFIILVYLLINCGNTGPWLK
KVLKCHTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAPEISPLEVLERDKATQ
LLLKQDKVPEPTSLSSNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYAEEDPDEG
GAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERL
RPSLQERVPRDWDPQPLGPPTPGVPDLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSR
PPGQGEFRALNARLPLNTDAYLSLQELQGQDPTHLV
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgattgtaagtttcctgaggcctccccagccatgtggaactggcttccttcctcggctc
caccctgtggatgtaatggcggcctctgctctgtcctggcgtctgcccctcctcatcctc
ctcctgcccctggctaccccttgggcatctgcagcggtgaatggcacttcccagttcaca
tgcttctacaactcgagagccaacatctcctgtgtctggagccaagatggggctctgcag
gacacttcctgccaagtccatgcctggccggacagacggcggtggaaccaaacctgtgag
ctgctccccgtgagtcaagcatcctgggcctgcaacctgatcctcggagccccagattct
cagaaactgaccgcagtggacatcgtcaccctgagggtgatgtgccgtgaaggggtgcga
tggaggatgatggctatccaggacttcaaaccctttgagaaccttcgcctgatggccccc
atctccctccgagtcgtccacgtggagacccacagatgcaacataagctgggaaatctcc
caagcctcccactactttgaaagacacctggagttcgaggcccggacgctgtccccaggc
cacacctgggaggaggcccccctgctgactctcaagcagaagcaggaatggatctgcctg
gagacactcaccccagacacccagtatgagtttcaggtacgggtcaagcctctgcaaggc
gagttcacgacctggagcccctggagccagcccctggccttcaggacaaagcctgcaggc
cttgggaaggacaccattccgtggcttggccacctcctcgtgggcctcagcggggctttt
ggcttcatcatcttagtgtacttgttgatcaattgcgggaacaccgggccgtggctgaag
aaggtcctgaagtgtcacaccccagacccctcaaagttcttttcccagctgagctcagag
catggaggagacgtccagaagtggctctcttcgcccttcccctcatcgtccttcagccct
ggtggcttggcacctgagatctcgccactagaagtgctggagagggacaaggcgacgcag
ctgctcctgaagcaggacaaggtgcctgagcccacatccttaagcagcaaccactcgctg
accagctgcttcaccaaccagggttacttcttcttccacctcccggatgccttggagata
gaggcctgccaggtgtactttacttacgacccctatgcagaggaagaccctgatgagggt
ggggccggggcacccacagggtcttccccccaacccctgcagcctctgtcaggggaggac
gacgcctactgcaccttcccctccagggatgacctgctgctcttctcccccagtctcctc
ggtggccccagccccccaagcactgcccctgggggcagcggggctggtgaagaaaggctg
cgcccttccctgcaagaaagagtccccagagactgggacccccagcccctggggcctccc
accccgggagtcccagacctggtggattttcagccaccccctgagctggtgcttcgagag
gctggggaggaggtccctgacgctggccccagggagggggtcagtttcccctggtccagg
cctcctgggcagggggaattcagggcccttaatgctcgcctgcccctgaacactgatgcc
tacttgtctctccaagaactccagggtcaggacccaactcacttggtgtag

KEGG   Pongo abelii (Sumatran orangutan): 100461113
Entry
100461113         CDS       T01416                                 

Gene name
IL9R
Definition
(RefSeq) interleukin-9 receptor
  KO
K05073  interleukin 9 receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100461113 (IL9R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100461113 (IL9R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100461113 (IL9R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100461113 (IL9R)
   04090 CD molecules [BR:pon04090]
    100461113 (IL9R)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100461113 (IL9R)
CD molecules [BR:pon04090]
 Proteins
  100461113 (IL9R)
SSDB
Other DBs
NCBI-GeneID: 100461113
NCBI-ProteinID: XP_024096623
Ensembl: ENSPPYG00000020907
LinkDB
Position
X
AA seq 331 aa
MPQTCDGTGQMHLGSNCCKNGQTLLQRTCPGVSCCGWWFQAARSILGKGPSAQSLAGWTL
EIEALRRDMGTWLLACTCICTCVCLGVSVTGEGQGPRARTFTCLTNNILRIDCHWSAPEL
GQGSSPWLLFTRLLAAHISASCGAVSAPSCCHLRQYSCHLTISPSLSTTACLGGSRSAWW
TRSTCPGDTSNVSSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVT
WLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIP
PLGWPDNTLVAVSVFLLLIGLTYLLFKLSPR
NT seq 996 nt   +upstreamnt  +downstreamnt
atgcctcagacttgtgatgggactgggcagatgcatctgggaagtaactgctgcaagaac
ggacagacactgctgcagagaacttgccccggtgtttcatgctgtggctggtggttccag
gctgcacgctccattctaggaaaggggccctcagcccagtcccttgcaggctggaccttg
gagattgaggccctgaggcgagacatgggcacctggctcctggcctgcacctgcatctgc
acctgtgtctgcttgggagtctctgtcacaggggaaggacaagggccaagggctagaacc
ttcacctgcctcaccaacaacattctcaggatcgattgccactggtctgccccagagctg
ggacagggctccagcccctggctcctcttcaccaggctcctggcggcacacataagtgca
tcttgcggggcagtgagtgcaccgtcgtgctgccacctgaggcagtactcatgccatctg
acaatttcaccatcactttccaccactgcatgtctgggagggagcaggtcagcctggtgg
acccggagtacctgccccggagacacgagcaacgtcagctctggccactgcatcctgacc
tggagcatcagtcctgccttggagccaatgaccacacttctcagctatgagttggccttc
aagaagcaggaagaggcctgggagcaggcccagcacagggatcacattgtcggggtgacc
tggcttatacttgaagcctttgagctggaccctggctttatccatgaggccaggctgcgt
gtccagatggccacactggaagatgatgtggtagaggaggagcgttatacaggccagtgg
agtgagtggagccagcctgtgtgcttccaggctccccagagacaaggccctctgatccca
cccttggggtggccagacaacacccttgttgctgtgtccgtctttctcctgctgattggc
ctgacctacctcctgttcaagctttcgcccaggtag

KEGG   Pongo abelii (Sumatran orangutan): 100461835
Entry
100461835         CDS       T01416                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04068  FoxO signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
pon05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100461835 (IL7R)
   04068 FoxO signaling pathway
    100461835 (IL7R)
   04151 PI3K-Akt signaling pathway
    100461835 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100461835 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100461835 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461835 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    100461835 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100461835 (IL7R)
   04090 CD molecules [BR:pon04090]
    100461835 (IL7R)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL2 receptor family
   100461835 (IL7R)
CD molecules [BR:pon04090]
 Proteins
  100461835 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 100461835
NCBI-ProteinID: XP_002815533
Ensembl: ENSPPYG00000015396
UniProt: H2PFB9
LinkDB
Position
5
AA seq 459 aa
MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKK
IDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWMH
VNLSSTKLTLLQRKLQSAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP
ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDMFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
FGRDSSLTCLAGNVSACDAPILSSSRSLDCRENGKNGPHVYQDLLLSLGTTNSTLLPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacaattctaggtacaacttttggcatggttttttctttacttcaagtcgtttctgga
gaaagtggctatgctcaaaatggagacttggaagatgcagaactggatgactactcattc
tcatgctatagccagttggaagtgaatggatcgcagcactcactgacctgtgcttttgag
gacccagatgtcaacatcaccaatctggaatttgaaatatgtggggccctcgtggaggta
aagtgcctgaatttcaggaaactacaagagatatatttcatcgagacaaagaaattctta
ctgattggaaagagcaatatatgtgtgaaggttggagaaaagagtctaacctgcaaaaaa
atagacctaaccactatagttaaacctgaggctccttttgacctgagtgtcatctatcgt
gaaggagccaatgactttgtggtgacatttaatacatcacacttgcaaaagaagtacgta
aaagttttaatgcacgatgtagcttaccgccaggaaaaggatgaaaacaaatggatgcat
gtgaatttatccagcacaaagctgacactcctgcagagaaagctccaatcggcagcaatg
tatgagattaaagttcgatccatccctgatcactattttaaaggcttctggagcgaatgg
agtccaagttattacttcagaactccagagatcaataatagctcaggggagatggatcct
atcttactaaccatcagcattttgagttttttctctgtcgctctgttggtcatcttggcc
tgtgtgttatggaagaaaaggattaagcctatcgtatggcccagtctccctgatcataag
aagactctggaacatctttgtaagaaaccaagaaagaatttaaatgtgagtttcaatcct
gaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagtg
gaaggttttctgcaagatatgtttcctcagcaactagaagaatctgagaagcagaggctt
ggaggggatgtgcagagccccaactgcccatctgaggatgtagtcatcaccccagaaagt
tttggaagagattcatccctcacatgcctggctgggaatgtcagtgcatgtgatgcccct
attctctcctcttccaggtccctagactgcagggagaatggcaagaatgggcctcatgtg
taccaggacctcctgcttagccttgggactacaaacagcaccctgctccctccattttct
ctccaatctggaatcctgacattgaacccagttgctcagggtcagccaattcttacttcc
ctgggatcaaatcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccagtga

KEGG   Pongo abelii (Sumatran orangutan): 100461924
Entry
100461924         CDS       T01416                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04080  Neuroactive ligand-receptor interaction
pon04152  AMPK signaling pathway
pon04630  JAK-STAT signaling pathway
pon04920  Adipocytokine signaling pathway
pon04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100461924 (LEPR)
   04152 AMPK signaling pathway
    100461924 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100461924 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    100461924 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100461924 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100461924 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100461924 (LEPR)
   04090 CD molecules [BR:pon04090]
    100461924 (LEPR)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  Prolactin receptor family
   100461924 (LEPR)
CD molecules [BR:pon04090]
 Proteins
  100461924 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 100461924
NCBI-ProteinID: XP_024102829
Ensembl: ENSPPYG00000001267
LinkDB
Position
1
AA seq 1165 aa
MICQKFCVVLLHWEFIYVITAFNLSYPITPWRFKLSCMPPNSTYDYFLLPAGLSKNTSNS
NGHYETAAEPKFNSSGTHFSNLSKTTYHCCFRSEQDRNCSLCADNIEGKTFVSTVDSLVF
QQIGANWNIQCWLKGDLKLFICYVESLFKNPFKNYNYKVHLLYVLPEVLEDSPLVPQKGS
FQMVHCNCSVHECCECLVPVPTAKLNDTLLMSLKITSGGVIFQSPLMSVQPINMVKPDPP
LGLHMEITDDGNLKISWSSPPLVPFPLQYQVKYSENSTPVIREADKIVSATSLLVDSILS
GSSYEVQVRGKRLDGPGIWSDWSTPHVFTTQDVIYFPPKILTSVGSNVSLHCIYKNENKI
VPSKKIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHH
RYAELYVIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIH
PISEPKDCYLQSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPP
SSVKAEITINIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPV
PDMCAVYAVQVRCKRLDGLGYWSNWSNPAYTVVMDIKVPMRGPEFWRIINGDTMKKEKNV
TLLWKPLMKNDSLCSVQRYVINHHTSCNGTWSEDVGNHTKFTFPWTEQAHTVTVLAINSI
GASVANFNLTFSWPMSKVNIVQSLSAYPLNSSCVILSWIVSPSDYKLMYFIIEWKNLNED
GEIKWLRISSSVKKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQNDA
GLYVIVPVIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFI
KHTASVTCGPLLLEPETISEDISVDTSWKNKDEMVPTTVVSLLSTTDLEKGSVCISDQFN
SVNFSEAEGTEVTYEDESQRQPFVKYATLISNSKPSETGEEQGLINSSVTKCFSSKNSPL
KDSFSNSSWEIEAQAFFILSDQRPNIISPHLTFSEGLDELLKLEGNFPEENNDEKSVYYV
GVTSIKKRESGVLLTDKSRVLCPFPAPCLFTDIRVLQDSCSHFVENNFNLGTSSKKTFAS
YMPQFQTCSTQTHKIMENKMCDLTV
NT seq 3498 nt   +upstreamnt  +downstreamnt
atgatttgtcaaaagttctgtgtggttttgttacattgggaatttatttatgtgataact
gcatttaacttgtcatatccaattactccttggagatttaagttgtcttgcatgccacca
aattcaacctatgactacttccttttgcctgctggactctcaaagaatacttcaaattcg
aatggacattatgagacagctgctgaacctaagtttaattcaagtggtactcacttttct
aacttatccaaaacaacttaccactgttgctttcggagtgagcaagatagaaactgctcc
ttatgtgcagacaacattgaaggaaagacatttgtttcaacagtagattctttagttttt
caacaaataggtgcaaactggaacatacagtgctggctaaaaggagacttaaaattattc
atctgttatgtggagtcattatttaagaatccattcaagaattataactataaggtccat
cttttatatgttctgcctgaagtgttagaagattcacctctggttccccaaaaaggcagt
tttcagatggttcactgcaattgcagtgttcatgaatgttgtgaatgtcttgtgcctgtg
ccaacagccaaacttaacgacactctccttatgagtttgaaaatcacatctggtggagta
atcttccagtcacctctaatgtcagttcagcccataaatatggtgaagcctgatccacca
ttaggtttgcatatggaaatcacagatgatggtaatttaaagatttcgtggtccagcccg
ccattggtaccatttccacttcaatatcaagtgaaatattcagagaattctacaccagtt
atcagagaagctgacaagattgtctcagctacatccctgctggtagacagtatactttct
gggtcttcatatgaggttcaggtgaggggcaagagactggatggcccaggaatctggagt
gactggagtactcctcatgtctttaccacacaagatgtcatatactttccacctaaaatt
ctgacgagtgttgggtctaatgtgtctttacactgcatctataagaatgaaaacaagatt
gttccctcaaaaaagattgtttggtggatgaatttagctgagaaaattcctcaaagccag
tatgatgttgtgagtgatcatgttagcaaggttacttttttcaatctgaatgaaaccaaa
cctcgaggaaagtttacctatgatgcagtgtactgctgcaatgaacatgaatgccatcat
cgctatgctgaattatatgtgattgatgtcaatatcaatatctcatgtgaaactgatggg
tacttaactaaaatgacttgcagatggtcaaccagtacaatccagtcacttgcggaaagc
actttgcaattgaggtatcataggagcagcctttactgttctgatattccatctattcat
cccatatctgagcccaaagattgctatttgcagagtgatggtttttatgaatgcattttc
cagccaatcttcctattatctggctacacaatgtggattaggatcaatcactctctaggt
tcacttgactctccaccaacatgtgtccttcctgattctgtggtgaagccactgcctcca
tccagtgtgaaagcagaaattactataaacattggattattgaaaatatcttgggaaaag
ccagtctttccagagaataaccttcaattccagattcgctatggtttaagtggaaaagaa
gtacaatggaagatgtatgaggtttatgatgcaaaatcaaaatctgtcagtctcccagtt
ccagacatgtgtgcagtctatgctgttcaggtgcgctgtaagaggctagatggactggga
tattggagtaattggagcaatccagcctacacagttgtcatggatataaaagttcctatg
agaggacctgaattttggagaataattaatggagatactatgaaaaaggagaaaaatgtc
actttactttggaagcctctgatgaaaaatgactcattgtgcagtgttcagagatatgtg
ataaaccatcatacttcctgcaatggaacatggtcagaagatgtgggaaatcacacgaaa
ttcactttcccgtggacagagcaagcacatactgttacggttctggccatcaattcaatt
ggtgcttctgttgcaaattttaatttaaccttttcatggcctatgagcaaagtaaatatc
gtgcagtcactcagtgcttatcctttaaacagcagttgtgtgattctttcctggatagta
tcacccagtgattacaagctaatgtattttattattgagtggaaaaatcttaatgaagat
ggtgaaataaaatggcttagaatctcttcatctgttaagaagtattatatccatgatcat
tttatccccattgagaagtaccagttcagtctttacccaatatttatggaaggagtggga
aaaccaaagataattaatagtttcactcaagatgatattgaaaaacaccagaatgatgca
ggtttatatgtaattgtgccagtaattatttcctcttccatcttattgcttggaacatta
ttaatatcacaccaaagaatgaaaaagctgttttgggaagatgttccaaaccccaagaat
tgttcctgggcacaaggacttaattttcagaagccagaaacgtttgagcatctttttatc
aagcatacagcatcagtgacatgtggtcctcttcttttggagcctgaaacaatttcagaa
gatatcagtgttgatacatcatggaaaaataaagatgagatggtgccaacaactgtggtc
tctctactttcaacaacagatcttgaaaagggttctgtttgtattagtgaccagttcaac
agtgttaacttctctgaggctgagggtaccgaggtaacctatgaggacgaaagccagaga
caaccctttgttaaatatgccacgctgatcagcaactctaaaccaagtgaaactggtgaa
gaacaagggcttataaatagttcagtcaccaagtgcttctctagcaaaaattctccattg
aaggattctttctctaatagctcatgggagatagaggcccaggcattttttatattatca
gatcagcgtcccaacataatttcaccacacctcacattctcagaaggattggatgaactt
ttgaaattggagggaaatttccctgaagaaaataatgatgaaaagtctgtctattatgta
ggggtcacctcaatcaaaaagagagagagtggtgtgcttttgactgacaagtcaagggta
ttgtgcccattcccagccccctgtttattcacggacatcagagttctccaggacagttgc
tcacactttgtagaaaataatttcaacttaggaacttctagtaagaagacttttgcatct
tacatgcctcaattccaaacttgttctactcagactcataagatcatggaaaacaagatg
tgtgacctaactgtgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100462256
Entry
100462256         CDS       T01416                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100462256
   04151 PI3K-Akt signaling pathway
    100462256
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100462256
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100462256
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100462256
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462256
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100462256
   04090 CD molecules [BR:pon04090]
    100462256
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL3 receptor family
   100462256
CD molecules [BR:pon04090]
 Proteins
  100462256
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind Tissue_fac
Other DBs
NCBI-GeneID: 100462256
NCBI-ProteinID: XP_002834754
LinkDB
Position
X
AA seq 144 aa
GKPRAGAENLTCWIHDVDFLSCSWAVGPAAPADVQYDLYLNIANRRQQYECLHYKTDARG
TRIGCRFDDISRLSSGSQSSHILVRGRSAAFSIPCTDKFVVFSQIEILTPPNMTAKCNKT
HSFMHWKMRSHFNRKFRYELQIQK
NT seq 434 nt   +upstreamnt  +downstreamnt
gtgggaagcctcgggcaggtgcggagaatctgacctgctggattcacgatgtggatttct
tgagctgcagctgggcagtaggcccagcggcccccgctgatgtccagtacgacctgtact
tgaacattgccaacaggcgtcaacagtacgagtgtcttcactacaaaacggatgctcggg
gaacacgtatcgggtgtcgtttcgatgacatctctcgactctccagcggttctcaaagtt
cccacatcctggtgaggggcaggagcgcagccttcagtatcccctgcacagataagtttg
tcgtcttttcacagattgagatattaactccacccaacatgactgcaaagtgtaataaga
cacattccttcatgcactggaaaatgagaagtcatttcaatcgcaaatttcgctatgagc
ttcagatacaaaag

DBGET integrated database retrieval system