KEGG   Pongo abelii (Sumatran orangutan): 100171596Help
Entry
100171596         CDS       T01416                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial precursor
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00053  Ascorbate and aldarate metabolism
pon00071  Fatty acid degradation
pon00280  Valine, leucine and isoleucine degradation
pon00310  Lysine degradation
pon00330  Arginine and proline metabolism
pon00340  Histidine metabolism
pon00380  Tryptophan metabolism
pon00410  beta-Alanine metabolism
pon00561  Glycerolipid metabolism
pon00620  Pyruvate metabolism
pon01100  Metabolic pathways
Module
pon_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100171596 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    100171596 (ALDH2)
   00620 Pyruvate metabolism
    100171596 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100171596 (ALDH2)
   00561 Glycerolipid metabolism
    100171596 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100171596 (ALDH2)
   00310 Lysine degradation
    100171596 (ALDH2)
   00330 Arginine and proline metabolism
    100171596 (ALDH2)
   00340 Histidine metabolism
    100171596 (ALDH2)
   00380 Tryptophan metabolism
    100171596 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100171596 (ALDH2)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100171596 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1235
Motif
Other DBs
NCBI-GeneID: 100171596
NCBI-ProteinID: NP_001124747
Ensembl: ENSPPYG00000004966
UniProt: Q5RF00
LinkDB All DBs
Position
12
AA seq 517 aa AA seqDB search
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYNVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgctgccgcccgcttcgggccccgcctgggccgccgcctcttgtcagctgcc
gccacccaggccgtgcctgcccccaaccagcagcccgaggtcttctgcaaccagatcttc
ataaacaatgaatggcatgatgccgtcagcaggaaaacattccccaccgtcaatccgtcc
actggagaggtcatctgtcaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggctgcccgggccgccttccagctgggctcaccttggcgccgcatggacgcatcacac
aggggccggctgctgaaccgcctggccgatctgatcgagcgggaccggacctacctggca
gccttggagaccctggacaatggcaagccctatgtcatctcctacctggtggatttggac
atggtcctcaaatgtctccggtattatgctggctgggctgataagtaccacgggaaaacc
attcccattgacggagacttcttcagctacacacgccatgaacccgtgggggtgtgcggg
cagatcattccgtggaatttcccgctcctgatgcaagcatggaagctgggcccagccttg
gcgactggaaacgtggttgtgatgaaggtagctgagcagacacccctcactgccctctat
gtggcgaacctgatcaaggaggccggctttccccctggtgtggtcaacattgtgcctgga
tttggccccacagctggggctgccattgcctcccatgaggatgtggacaaagtggcattc
acaggctccaccgagattggccgcgtaatccaggttgctgccgggagcagcaaccttaag
agagtgaccctggagctgggggggaagagccccaacatcatcatgtcagatgccgatatg
gattgggccgtggaacaggcccacttcgccctgttcttcaaccagggccagtgctgctgt
gccggctcccggaccttcgtgcaggaggacatctatgatgagtttgtggagcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgatagcaagaccgagcaggggccg
caggtggatgaaactcagtttaagaagatcctcggctacatcaacacagggaaacaagag
ggggcgaagctgctgtgtggtgggggcattgctgctgaccgtggttacttcatccagccc
actgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagatcctgaagttcaagaccatagaggaggttgttgggagagccaacaattcc
acgtacgggctggctgcagctgtcttcacaaaggatttggacaaggccaattacctgtcc
caggccctccaggcgggcactgtgtgggtcaactgctataatgtatttggagcccagtca
ccctttggtggctacaagatgtcggggagtggccgggagctgggcgagtacggcctgcag
gcatacactgaagtgaaaactgtcacagtcaaagtgcctcagaagaactcataa

DBGET integrated database retrieval system