KEGG   Pongo abelii (Sumatran orangutan): 100171625
Entry
100171625         CDS       T01416                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04115  p53 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04218  Cellular senescence
pon04310  Wnt signaling pathway
pon04340  Hedgehog signaling pathway
pon04371  Apelin signaling pathway
pon04390  Hippo signaling pathway
pon04510  Focal adhesion
pon04530  Tight junction
pon04630  JAK-STAT signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04934  Cushing syndrome
pon05160  Hepatitis C
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100171625 (CCND1)
   04340 Hedgehog signaling pathway
    100171625 (CCND1)
   04390 Hippo signaling pathway
    100171625 (CCND1)
   04371 Apelin signaling pathway
    100171625 (CCND1)
   04630 JAK-STAT signaling pathway
    100171625 (CCND1)
   04068 FoxO signaling pathway
    100171625 (CCND1)
   04151 PI3K-Akt signaling pathway
    100171625 (CCND1)
   04152 AMPK signaling pathway
    100171625 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100171625 (CCND1)
   04115 p53 signaling pathway
    100171625 (CCND1)
   04218 Cellular senescence
    100171625 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100171625 (CCND1)
   04530 Tight junction
    100171625 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100171625 (CCND1)
   04921 Oxytocin signaling pathway
    100171625 (CCND1)
   04919 Thyroid hormone signaling pathway
    100171625 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100171625 (CCND1)
   05206 MicroRNAs in cancer
    100171625 (CCND1)
   05205 Proteoglycans in cancer
    100171625 (CCND1)
   05203 Viral carcinogenesis
    100171625 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100171625 (CCND1)
   05212 Pancreatic cancer
    100171625 (CCND1)
   05225 Hepatocellular carcinoma
    100171625 (CCND1)
   05226 Gastric cancer
    100171625 (CCND1)
   05214 Glioma
    100171625 (CCND1)
   05216 Thyroid cancer
    100171625 (CCND1)
   05221 Acute myeloid leukemia
    100171625 (CCND1)
   05220 Chronic myeloid leukemia
    100171625 (CCND1)
   05218 Melanoma
    100171625 (CCND1)
   05219 Bladder cancer
    100171625 (CCND1)
   05215 Prostate cancer
    100171625 (CCND1)
   05213 Endometrial cancer
    100171625 (CCND1)
   05224 Breast cancer
    100171625 (CCND1)
   05222 Small cell lung cancer
    100171625 (CCND1)
   05223 Non-small cell lung cancer
    100171625 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100171625 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100171625 (CCND1)
   04934 Cushing syndrome
    100171625 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100171625 (CCND1)
   05162 Measles
    100171625 (CCND1)
   05160 Hepatitis C
    100171625 (CCND1)
   05163 Human cytomegalovirus infection
    100171625 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100171625 (CCND1)
   05169 Epstein-Barr virus infection
    100171625 (CCND1)
   05165 Human papillomavirus infection
    100171625 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100171625 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100171625
NCBI-ProteinID: NP_001124773
UniProt: Q5R6J5 A0A2J8U0V4
LinkDB
Position
11
AA seq 295 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAALTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNSFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaaaccatccgccgcgcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaaatgtgtgcagaaggaggtcctgccgtccatgcggaagatcgtc
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaagaagagccgactgcag
ctgctaggggccacttgcatgttcgtggcctctaagatgaaggagaccatccccctgacg
gccgagaagctatgcatctacaccgacaactccatccggcccgaggagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgccttgaccccgcacgatttc
attgaacacttcctctccaaaatgccagaggcggaggagaacaaacagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaatccaccc
tccatggtagcagcggggagcgtggtggccgcagtgcaaggcctgaacctgaggagcccc
aacagcttcctgtcctactaccgcctcacacgcttcctctccagagtgatcaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtcaagcctgcgc
caggcccagcagaacatggaccccaaggccgccgaggaggaggaagaggaggaggaggag
gtggacctggcttgcacacccaccgacgtgcgggacgtggacatctga

DBGET integrated database retrieval system