KEGG   Pongo abelii (Sumatran orangutan): 100171706
Entry
100171706         CDS       T01416                                 

Gene name
RASGRP3
Definition
(RefSeq) ras guanyl-releasing protein 3
  KO
K12362  RAS guanyl-releasing protein 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04662  B cell receptor signaling pathway
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100171706 (RASGRP3)
   04014 Ras signaling pathway
    100171706 (RASGRP3)
   04015 Rap1 signaling pathway
    100171706 (RASGRP3)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    100171706 (RASGRP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100171706 (RASGRP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100171706 (RASGRP3)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100171706 (RASGRP3)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 RasGEF_N
Other DBs
NCBI-GeneID: 100171706
NCBI-ProteinID: NP_001124846
Ensembl: ENSPPYG00000012501
UniProt: Q5REI3
LinkDB
Position
2A
AA seq 690 aa
MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPIIVLLMHRWYLSSTELAEKLLCMYR
NATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNPKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDEGFAKWENEKPRV
HAGVDVVDRGTEFEPDQDEGEETRQDVEDG
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgggatcaagtggccttgggaaagcagcaacattagatgaactactgtgcacttgcatt
gagatgtttgatgacaatggagagctggataatagttacttgccaataatagttctactg
atgcaccgatggtatttatcttccactgaattggcagaaaaacttctctgcatgtatcga
aatgccactggagaaagctgcaatgaatttcgattaaagatctgctacttcatgaggtac
tggattctgaagtttcctgcagagtttaatttggatcttggtttgattcgtatgactgag
gaatttcgggaagtagctagtcaactaggatatgaaaaacacgtcagcctcatcgacata
tccagcattccttcctatgactggatgagaagggtcacacagaggaaaaaagtatccaag
aagggaaaagcctgtctgctgtttgaccatctggagcccattgagttggctgagcacctc
acttttctggagcataaatcttttagaaggatctcgttcactgattaccaaagctatgtc
atccatggctgcctagagaataatccaaccttggaaagatcgattgctttatttaatgga
atctctaagtgggtccagttgatggttcttagcaaaccaaccccccagcaaagggcagaa
gtcatcacaaagtttatcaatgttgcaaagaagctccttcagctcaaaaattttaacacc
ctgatggcagtggtgggaggcctcagtcatagttccatttcacgcctcaaagagacccat
tctcatctttcttcagaagttacaaagaactggaatgaaatgacagagttggtctcctcc
aacggcaattactgcaattaccgcaaggcctttgccgactgcgatggcttcaaaatcccc
atccttggagtacacttgaaagacttgatagcagtccatgtcattttcccagactggaca
gaggagaataaagtgaacattgtgaaaatgcaccagctctccgttaccctgagtgaacta
gtctccctgcagaatgcctctcaccacttagaacccaacatggatttgatcaacctgctc
acgctttccctggacctctatcacactgaagatgatatttacaaactgtcactggtgctg
gagcctagaaatcctaaatcgcagcctacctcccctacgacacccaacaagcctgtggtg
cccctggagtgggcattaggggtgatgccaaagccagaccccacggtcatcaacaagcac
ataaggaaattagtggagtctgtatttagaaactatgatcacgaccatgatgggtacatt
tcccaagaggactttgaaagtatagctgccaattttcccttcttggattccttctgtgtt
ctggacaaagatcaggatggtctaattagtaaagatgaaatgatggcttacttcctgaga
gctaaatcccaactacactgtaaaatgggaccaggatttatccataattttcaggagatg
acctatctcaagccaacgttctgtgaacactgtgcgggatttctctggggcataatcaag
caaggatacaaatgcaaagactgtggagccaattgtcacaaacagtgcaaagacctcctg
gttctggcctgcaggagatttgcccgggcgccctccttgagcagtggccatgggtcactg
cctggaagcccctcgctgcccccagcgcaggatgaggtgtttgagttccctggagtcact
gctggacacagagatttagacagcagagccataacactggttacaggctcttctcgcaag
atctctgtgaggctacagagggccaccaccagccaggccacccagactgaacctgtctgg
tcagaggctggctggggggactcggggtcccacaccttccctaaaatgaaatccaagttc
catgacaaagcagcaaaggacgaaggctttgccaaatgggaaaatgagaagcccagggtg
catgctggtgtggatgttgtagaccggggcacggagtttgaacctgaccaggatgaagga
gaagagaccagacaggatgttgaggatggctga

KEGG   Pongo abelii (Sumatran orangutan): 100444206
Entry
100444206         CDS       T01416                                 

Gene name
RASGRP4
Definition
(RefSeq) RAS guanyl-releasing protein 4
  KO
K12363  RAS guanyl-releasing protein 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100444206 (RASGRP4)
   04014 Ras signaling pathway
    100444206 (RASGRP4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100444206 (RASGRP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100444206 (RASGRP4)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100444206 (RASGRP4)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_7 EF-hand_6 RasGEF_N EF-hand_1 SAMP
Other DBs
NCBI-GeneID: 100444206
NCBI-ProteinID: XP_002829207
Ensembl: ENSPPYG00000009935
UniProt: A0A2J8RE31
LinkDB
Position
19
AA seq 673 aa
MNRKDSKRKSHQECTGKTGGRGRPRQARRHKTCPSPREISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSAGSLCHGDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQ
ICHLVRYWLTQHPEVMHQDPQLEEVIGRFWATVAQEGNSAQRRLGDSSNLLSPGGPGPPL
PMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITPQDLRSYVLQGSVRGCPAL
EGSVGLSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQRLRQLQNFNTLMAVTGGLCHS
AISRLKDSHAHLSPDSTKALLELTELLASHNNYARYRRTWAGCAGFRLPVLGVHLKDLVS
LHEAQPDRLPDGRLHLPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTED
EIYELSYAREPRCPKSLPPSPFNAPLVVEWAPGVTPKPDRITLGRHVEQLVESVFKNYDP
EGRGTISQEDFERLSGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFL
HTFHEVTFRKPTFCDSCSGFLWGVTKQGYRCRECGLCCHKHCREQLKVECKKRPGAKGDA
GPPGAPVPSTPAPHASCGSEENLSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPV
MDPPSTASSKLDS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgaacagaaaagacagcaagaggaagtcccaccaggaatgcaccggaaagacaggaggg
cggggccggccccgccaagcgcgtcgccacaagacatgccccagcccccgggaaatcagc
aaggtcatggcttccatgaacctgggccttctgagtgagggcggctgcagcgaagatgag
ctgctggagaaatgcatccagtccttcgattcagctggcagcctgtgccatggggaccac
atgctcaacatggtgctggccatgcacagctgggtgctgccatctgccgacctggctgcc
cgcctgctgacctcataccagaaggccacaggggacacccaggagctgagacggctgcag
atctgtcacctggtcaggtactggctgacgcaacaccctgaggtgatgcaccaggatccc
cagctagaagaagtcataggtcgtttctgggccaccgtggcccaggagggcaactcggcc
cagagaagactgggagactcttctaacctcctgagccctggtggccctggccccccactc
cccatgagcagcccaggcctgggcaaaaagcgcaaagtgtccttgcttttcgaccacttg
gagacgggggagctggctcagcacctcacctacctggagttccggtccttccaggctatc
acgccccaggatctgcggagctacgttttgcagggctcagtacgaggctgcccggccctg
gagggctccgtaggtctcagcaacagcgtgtcccgctgggtgcaggtgatggtgctgagc
cgtcccgggcccctacagcgcgcacaggtgctggacaagttcattcacgtggcacagagg
ctccgccagctgcagaatttcaacacgctgatggcagtcacagggggcctatgtcacagt
gccatctccagactcaaggactcccatgcccacctgagccctgacagcaccaaggccctc
ctggagctcactgagctccttgcctcccacaacaactacgcccgctaccgccgcacctgg
gctggctgtgcgggcttccggctgcctgtactgggcgtgcacctcaaggacctggtgtcc
ctgcatgaggcacagcccgacaggttgcctgacggccgcctgcacctacccaagctgaac
aacctctacctgcggctgcaggagctggtggccctccaagggcagcatccaccctgcagc
gccaatgaggacctgctgcacctgctcacgctctccctggacctcttctacacggaagac
gagatctatgagctttcttatgcccgggagccgcgttgtcccaagagtctgccaccctcc
cccttcaacgcacctctggtggtggaatgggcccctggtgtgacacccaagccggacagg
atcacgctgggtcggcatgtggagcagctggtggagtctgtgttcaagaattatgaccct
gaaggccgaggaacaatctctcaggaggactttgagcgactctcgggcaattttcccttc
gcctgccatgggcttcacccacccccacgccaggggagaggctccttcagcagagaggag
ctgacagggtacctgctccgggccagcgccatctgctccaagctgggcctcgccttcctg
cacaccttccatgaggtcaccttccgaaagcctaccttctgcgacagctgcagtggcttc
ctctggggtgtcaccaagcaaggctaccgctgtcgggagtgcgggctgtgttgccacaaa
cactgcagagagcaactgaaggtagaatgtaagaagaggccaggggccaagggcgatgca
ggaccccccggagctcctgtcccatccacaccagctccccatgccagctgtggctccgag
gaaaatctctcctacacgctatccctggaacctgagactgggtgccagcttcgccatgcc
tggacccagactgaatccccacacccttcctgggaaacagatacggtcccctgcccagtg
atggacccaccatcaactgcatcctcgaagctggattcctag

KEGG   Pongo abelii (Sumatran orangutan): 100447844
Entry
100447844         CDS       T01416                                 

Gene name
RASGRP2
Definition
(RefSeq) RAS guanyl-releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04062  Chemokine signaling pathway
pon04611  Platelet activation
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100447844 (RASGRP2)
   04014 Ras signaling pathway
    100447844 (RASGRP2)
   04015 Rap1 signaling pathway
    100447844 (RASGRP2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100447844 (RASGRP2)
   04062 Chemokine signaling pathway
    100447844 (RASGRP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447844 (RASGRP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100447844 (RASGRP2)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100447844 (RASGRP2)
SSDB
Motif
Pfam: RasGEF EF-hand_1 C1_1 EF-hand_6 EF-hand_7 EF-hand_5 RasGEF_N EF-hand_8
Other DBs
NCBI-GeneID: 100447844
NCBI-ProteinID: XP_024111623
LinkDB
Position
11
AA seq 609 aa
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNLRHSSLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPTHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTV
EDGVFDIHL
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggcgggcaccctggacctggacaagggctgcacggtggaggagctgctccgcgggtgc
atcgaagccttcgatgactccgggaaggtgcgggacccgcagctggtgcgcatgttcctc
atgatgcacccctggtacatcccctcctctcagctggcggccaagctgctccacatctac
caacaatcccggaaggacaactccaattccctgcaggtgaaaacgtgccacctggtcagg
tactggatctccgccttcccagcggagtttgacttgaacccggagctggctgagcagatc
aaggagctgaaggctctgctagaccaagaagggaacctgcggcacagcagcctcatcgac
atagacagcgtccctacctacaagtggaagcggcaggtgactcagcggaaccctgtggga
cagaaaaagcgcaagatgtccctgttgtttgaccacctggagcccatggagctggcggag
catctcacctacttggagtatcgctccttctgcaagatcctgtttcaggactatcacagt
tttgtgactcatggctgcactgtggacaaccccgtcctggagcgattcatctccctcttc
aacagcgtctcgcagtgggtgcagctcatgatcctcagcaaacccacagccccgcagcgg
gccctggtcatcacacactttgtccacgtggcggagaagctgctgcagctgcagaacttc
aacacactgatggcagtggtcgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgttagccctgagaccatcaagctctgggagggtctcacggaactagtg
acggcaacaggcaactatggcaactaccggcgtcggctggcagcctgtgtgggcttccgc
ttccctatcctgggtgtgcacctcaaggacctggtggccctgcagctggcactgcctgac
tggctggacccagcccggacccggctcaacggggccaagatgaagcagctctttagcatc
ctggaggagctggccatggtgaccagcctgcggccaccagtacaggccaaccccgacctg
ctgagcctgctcacggtgtctctggatcagtatcagacggaggatgagctgtaccagctg
tccctgcagcgggagccacgctccaagtcctcgccaaccagccccacgagttgcacccca
ccaccccggcccccggtgctggaggagtggacatcggctgccaaacccaagctggatcag
gccctcgtggtggagcacatcgagaagatggtggagtctgtgttccggaactttgacgtc
gatggggatggccacatctcacaggaagaattccagatcatccgtgggaacttcccttac
ctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggagatg
gtctcctatttcctgcgctccagctccgtgttggggggccgcatgggcttcgtacacaac
ttccaggagagcaactccttgcgccctgtcgcctgccgccactgcaaagccctgatcctg
ggcatctacaagcagggcctcaaatgccgagcctgtggtgtgaactgccacaagcagtgc
aaggatcgcctgtcagtcgagtgtcggcgcagggcccagagtgtgagcctggaggggtct
gcaccctcaccctcacccacccacagccaccatcaccgcgccttcagcttctctctgccc
cgccctggcaggcgaggctccaggcctccagagatccgtgaggaggaggtacagacggtg
gaggatggggtgtttgacatccacttgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100451529
Entry
100451529         CDS       T01416                                 

Gene name
RASGRP1
Definition
(RefSeq) RAS guanyl-releasing protein 1 isoform X1
  KO
K04350  RAS guanyl-releasing protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04611  Platelet activation
pon04660  T cell receptor signaling pathway
pon05200  Pathways in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100451529 (RASGRP1)
   04014 Ras signaling pathway
    100451529 (RASGRP1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100451529 (RASGRP1)
   04660 T cell receptor signaling pathway
    100451529 (RASGRP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100451529 (RASGRP1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100451529 (RASGRP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100451529 (RASGRP1)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100451529 (RASGRP1)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_6 RasGEF_N EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_8 Cep57_CLD_2 SPARC_Ca_bdg bZIP_1 UPF0242
Other DBs
NCBI-GeneID: 100451529
NCBI-ProteinID: XP_024088654
Ensembl: ENSPPYG00000006337
LinkDB
Position
15
AA seq 797 aa
MGTLGKAREAPRKPSHGCRAAPKARLEAKPANSPFPSHPSLAQITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIIISSAELLQKVITLYKDALAKNSPG
LCLKICYFVRYWITEFWVMFKMDARLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVA
PTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKI
SLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVR
KRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQ
LEKSNHVLAQMEQGDCS
NT seq 2394 nt   +upstreamnt  +downstreamnt
atgggcaccctgggcaaggcgagagaggctccgcggaaaccttcccatggctgcagagct
gcccctaaagcaagactagaggcaaagccagccaacagccccttcccctcccatcccagc
ttggcccagatcacccagttccgaatgatggtgtctctgggacatttagccaaaggagcc
agcctggacgatctcattgacagctgcattcaatcttttgatgcagatggaaacctgtgt
cgaagtaaccaactgttgcaagtcatgctgaccatgcaccgaattatcatctcctctgca
gaactgctccaaaaagttatcaccctctataaggatgctttggcaaagaattcaccagga
ctttgcctgaagatctgttattttgtaaggtattggataacagaattctgggtcatgttt
aaaatggacgcccgcttgacagacactatggaggagtttcaggaactggtgaaagctaag
ggtgaggagttacactgccgcctgattgacacaactcaaatcaatgcccgtgactggtcc
aggaaacttactcaaaggataaaatcaaataccagcaagaaacggaaagtctccctgctc
tttgaccatctggaaccagaagagctatctgagcacctcacctaccttgagttcaagtcc
ttccgaaggatatcgttctctgattatcagaattaccttgtaaatagctgtgtgaaggaa
aaccccaccatggagcgatctattgctctgtgcaacggcatctcccagtgggtacaactg
atggttctcagccgccccacgccgcagctccgagcagaagtcttcatcaagttcatccag
gtggctcagaagctccaccaactacagaacttcaatacactgatggctgtgataggtggg
ctgtgtcacagctcaatctcgaggctcaaggagacaagttcgcatgtcccacatgaaatc
aataaggttctcggtgagatgactgagctgctgtcctcctccagaaactatgacaattac
cggcgagcctatggagagtgcactgacttcaagatccccattctgggtgtgcatctcaag
gacctcatctccctgtatgaagccatgcctgactatctggaggacgggaaagtgaacgtc
cacaagttactggccctgtacaatcatatcagtgaattggtccagctgcaagaggtggcc
ccacccttggaggctaacaaggacttggtacacttgctgacgttatccctggatctttac
tacactgaggatgaaatctatgagctttcctatgcccgggaaccaaggaaccacagagct
ccaccactaacaccttcaaagccaccagtagtagtggactgggcttctggagtgtctccc
aaacctgatccaaagaccattagcaaacacgtccagaggatggtggactctgtcttcaag
aactatgatcacgaccaggatggatacatttctcaggaggaatttgaaaagattgctgcg
agttttccattttccttctgtgtgatggacaaagacagggaaggcctcatcagcagggat
gagatcacagcctacttcatgcgagccagctcaatctattccaagctgggcctgggcttt
cctcacaacttccaagagaccacctacctgaagcccactttttgtgacaactgtgctgga
tttctctggggagtgatcaaacaaggatatcgatgtaaagactgcgggatgaactgccac
aaacaatgcaaagatctggttgtgtttgagtgcaagaagcgagccaagaacccagtagct
cccacagagaacaacacttctgtggggccagtgtccaacctttgctcattgggagccaaa
gatctgctccatgcacctgaggaaggaccttttacattccctaatggggaggctgtggaa
catggtgaggagagtaaggatcggaccatcatgctgatgggagtgtcctcacagaagatt
tctcttcggctgaagagggctgttgcccacaaggccacccagactgaatcacagccttgg
attggcagtgagggcccttcaggtccctttgtactgtcttccccaaggaagacagcccag
gatactctttatgtgcttcccagtcccacctctccatgtcctagcccagtcttggtcaga
aagcgggcttttgtcaagtgggagaataaagactccctcataaaatcaaaggaggagctc
cgtcacctcagactgcctacctaccaagagctggaacaggaaataaatactctgaaagca
gataatgatgccctaaagatccaactgaaatatgcacagaagaaaatagaatccctccag
cttgaaaaaagcaatcatgtcttagctcaaatggagcagggtgactgttcttag

DBGET integrated database retrieval system