KEGG   Pongo abelii (Sumatran orangutan): 100171710
Entry
100171710         CDS       T01416                                 

Gene name
GNG5
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 precursor
  KO
K04542  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100171710 (GNG5)
   04371 Apelin signaling pathway
    100171710 (GNG5)
   04151 PI3K-Akt signaling pathway
    100171710 (GNG5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100171710 (GNG5)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100171710 (GNG5)
  09156 Nervous system
   04724 Glutamatergic synapse
    100171710 (GNG5)
   04727 GABAergic synapse
    100171710 (GNG5)
   04725 Cholinergic synapse
    100171710 (GNG5)
   04728 Dopaminergic synapse
    100171710 (GNG5)
   04726 Serotonergic synapse
    100171710 (GNG5)
   04723 Retrograde endocannabinoid signaling
    100171710 (GNG5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100171710 (GNG5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100171710 (GNG5)
  09165 Substance dependence
   05032 Morphine addiction
    100171710 (GNG5)
   05034 Alcoholism
    100171710 (GNG5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100171710 (GNG5)
   05163 Human cytomegalovirus infection
    100171710 (GNG5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100171710 (GNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100171710 (GNG5)
   04031 GTP-binding proteins [BR:pon04031]
    100171710 (GNG5)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100171710 (GNG5)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100171710 (GNG5)
SSDB
Motif
Pfam: G-gamma CUPID FtsX_ECD Suv3_N
Other DBs
NCBI-GeneID: 100171710
NCBI-ProteinID: NP_001124849
Ensembl: ENSPPYG00000001205
UniProt: Q5REH7 A0A2J8WQH8
LinkDB
Position
1
AA seq 68 aa
MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR
PQKVCSFL
NT seq 207 nt   +upstreamnt  +downstreamnt
atgtctggctcctccagcgtcgccgctatgaagaaagtggttcaacagctccggctggag
gccggactcaaccgcgtaaaagtttcccaggcagctgcagacttgaaacagttctgtctg
cagaatgctcaacatgaccctctgctgactggagtatcttcaagtacaaatcccttcaga
ccccagaaagtctgttcctttttgtag

KEGG   Pongo abelii (Sumatran orangutan): 100171833
Entry
100171833         CDS       T01416                                 

Gene name
GNB5
Definition
(RefSeq) guanine nucleotide-binding protein subunit beta-5
  KO
K04539  guanine nucleotide-binding protein subunit beta-5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100171833 (GNB5)
   04371 Apelin signaling pathway
    100171833 (GNB5)
   04151 PI3K-Akt signaling pathway
    100171833 (GNB5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100171833 (GNB5)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100171833 (GNB5)
  09156 Nervous system
   04724 Glutamatergic synapse
    100171833 (GNB5)
   04727 GABAergic synapse
    100171833 (GNB5)
   04725 Cholinergic synapse
    100171833 (GNB5)
   04728 Dopaminergic synapse
    100171833 (GNB5)
   04726 Serotonergic synapse
    100171833 (GNB5)
   04723 Retrograde endocannabinoid signaling
    100171833 (GNB5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100171833 (GNB5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100171833 (GNB5)
  09165 Substance dependence
   05032 Morphine addiction
    100171833 (GNB5)
   05034 Alcoholism
    100171833 (GNB5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100171833 (GNB5)
   05163 Human cytomegalovirus infection
    100171833 (GNB5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100171833 (GNB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100171833 (GNB5)
   04031 GTP-binding proteins [BR:pon04031]
    100171833 (GNB5)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100171833 (GNB5)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100171833 (GNB5)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like DUF2538
Other DBs
NCBI-GeneID: 100171833
NCBI-ProteinID: NP_001124960
UniProt: Q5RDY7
LinkDB
Position
15
AA seq 353 aa
MATEGLHENETLASLKSEAESLKGKLEEERAKLRDVELHQVAERVEALGQFVMKTRRTLK
GHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAI
ACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALW
DVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHES
DINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFA
GYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggcaaccgaggggctgcacgagaatgagacgctggcgtcgctgaagagcgaggccgag
agcctcaagggcaagctggaggaggagcgagccaagctgcgcgatgtggagctgcaccag
gtggcggagcgggtggaggccctggggcagtttgtcatgaagaccagaaggaccctcaaa
ggccatgggaacaaagtcttgtgcatggactggtgcaaagataagaggaggatcgtgagc
tcgtcacaggatgggaaggtgatcgtgtgggattccttcaccacgaacaaggagcacgcg
gtcactatgccctgcacgtgggtgatggcatgtgcttatgccccatcaggatgtgccatt
gcttgtggtggtttggataataagtgttctgtgtaccccttgacgtttgacaaaaatgaa
aacatggctgccaaaaagaagtctgttgctatgcacaccaactacctgtcggcctgcagc
ttcaccaactctgacatgcagatcctgacagcgagcggtgatggcacgtgtgccctgtgg
gacgtggagagcgggcagctgctgcagagcttccacggacatggggctgacgtcctctgc
ttggacctggccccctcagaaactggaaacaccttcgtgtctgggggatgtgacaagaaa
gccatggtgtgggacatgcgctccggccagtgcgtgcaggcctttgaaacacatgaatct
gacatcaacagcgtccggtactaccccagtggagatgcctttgcttcagggtcagatgat
gctacgtgtcgcctctatgacctgcgggcagacagggaggttgccatctattccaaagaa
agtatcatatttggagcatccagcgtggacttctccctcagtggtcgcctgctgtttgct
ggatacaatgattacactatcaacgtctgggatgttctcaaggggtcccgggtctccatc
ctgtttggacatgaaaatcgcgttagcactctgcgagtttctcccgatgggactgctttc
tgctctggatcatgggatcataccctcagagtctgggcctaa

KEGG   Pongo abelii (Sumatran orangutan): 100172647
Entry
100172647         CDS       T01416                                 

Gene name
GNG2
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 precursor
  KO
K07826  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100172647 (GNG2)
   04371 Apelin signaling pathway
    100172647 (GNG2)
   04151 PI3K-Akt signaling pathway
    100172647 (GNG2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100172647 (GNG2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100172647 (GNG2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100172647 (GNG2)
   04727 GABAergic synapse
    100172647 (GNG2)
   04725 Cholinergic synapse
    100172647 (GNG2)
   04728 Dopaminergic synapse
    100172647 (GNG2)
   04726 Serotonergic synapse
    100172647 (GNG2)
   04723 Retrograde endocannabinoid signaling
    100172647 (GNG2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100172647 (GNG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172647 (GNG2)
  09165 Substance dependence
   05032 Morphine addiction
    100172647 (GNG2)
   05034 Alcoholism
    100172647 (GNG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100172647 (GNG2)
   05163 Human cytomegalovirus infection
    100172647 (GNG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100172647 (GNG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100172647 (GNG2)
   04031 GTP-binding proteins [BR:pon04031]
    100172647 (GNG2)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100172647 (GNG2)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100172647 (GNG2)
SSDB
Motif
Pfam: G-gamma CP12 FtsX_ECD zf-CHC2 CHASE8
Other DBs
NCBI-GeneID: 100172647
NCBI-ProteinID: NP_001125723
Ensembl: ENSPPYG00000005812
UniProt: Q5R7U4
LinkDB
Position
14
AA seq 71 aa
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAEEDPLLTPVPASENP
FREKKFFCAIL
NT seq 216 nt   +upstreamnt  +downstreamnt
atggccagcaacaacaccgccagcatagcacaagccaggaagctggtagagcagcttaag
atggaagccaacatcgacaggataaaggtgtccaaggcagctgcagatttgatggcctac
tgtgaagcgcatgccgaggaagatcccctcctgacccctgttccggcttcagaaaacccg
tttagggagaagaagtttttctgtgccatcctttaa

KEGG   Pongo abelii (Sumatran orangutan): 100173039
Entry
100173039         CDS       T01416                                 

Gene name
GNG12
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 precursor
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04810  Regulation of actin cytoskeleton
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100173039 (GNG12)
   04014 Ras signaling pathway
    100173039 (GNG12)
   04371 Apelin signaling pathway
    100173039 (GNG12)
   04151 PI3K-Akt signaling pathway
    100173039 (GNG12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100173039 (GNG12)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100173039 (GNG12)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100173039 (GNG12)
  09156 Nervous system
   04724 Glutamatergic synapse
    100173039 (GNG12)
   04727 GABAergic synapse
    100173039 (GNG12)
   04725 Cholinergic synapse
    100173039 (GNG12)
   04728 Dopaminergic synapse
    100173039 (GNG12)
   04726 Serotonergic synapse
    100173039 (GNG12)
   04723 Retrograde endocannabinoid signaling
    100173039 (GNG12)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100173039 (GNG12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100173039 (GNG12)
  09165 Substance dependence
   05032 Morphine addiction
    100173039 (GNG12)
   05034 Alcoholism
    100173039 (GNG12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100173039 (GNG12)
   05163 Human cytomegalovirus infection
    100173039 (GNG12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100173039 (GNG12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100173039 (GNG12)
   04031 GTP-binding proteins [BR:pon04031]
    100173039 (GNG12)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100173039 (GNG12)
  Exosomal proteins of colorectal cancer cells
   100173039 (GNG12)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100173039 (GNG12)
SSDB
Motif
Pfam: G-gamma CP12
Other DBs
NCBI-GeneID: 100173039
NCBI-ProteinID: NP_001126086
Ensembl: ENSPPYG00000001253
UniProt: Q5RBQ0 A0A2J8WPT7
LinkDB
Position
1
AA seq 72 aa
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
NT seq 219 nt   +upstreamnt  +downstreamnt
atgtccagcaaaacagcaagcaccaacaatatagcgcaggcaaggagaactgtgcagcag
ttaagattagaagcctccattgaaagaataaaggtttcgaaggcatcagcggacctcatg
tcctactgtgaggaacatgccaggagtgaccctttgctgataggaataccaacttcagaa
aaccctttcaaggataaaaaaacttgcatcatcttatag

KEGG   Pongo abelii (Sumatran orangutan): 100173664
Entry
100173664         CDS       T01416                                 

Gene name
GNB1
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
  KO
K04536  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04744  Phototransduction
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100173664 (GNB1)
   04371 Apelin signaling pathway
    100173664 (GNB1)
   04151 PI3K-Akt signaling pathway
    100173664 (GNB1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100173664 (GNB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100173664 (GNB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100173664 (GNB1)
   04727 GABAergic synapse
    100173664 (GNB1)
   04725 Cholinergic synapse
    100173664 (GNB1)
   04728 Dopaminergic synapse
    100173664 (GNB1)
   04726 Serotonergic synapse
    100173664 (GNB1)
   04723 Retrograde endocannabinoid signaling
    100173664 (GNB1)
  09157 Sensory system
   04744 Phototransduction
    100173664 (GNB1)
   04740 Olfactory transduction
    100173664 (GNB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100173664 (GNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100173664 (GNB1)
  09165 Substance dependence
   05032 Morphine addiction
    100173664 (GNB1)
   05034 Alcoholism
    100173664 (GNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100173664 (GNB1)
   05163 Human cytomegalovirus infection
    100173664 (GNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100173664 (GNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100173664 (GNB1)
   04031 GTP-binding proteins [BR:pon04031]
    100173664 (GNB1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100173664 (GNB1)
  Exosomal proteins of colorectal cancer cells
   100173664 (GNB1)
  Exosomal proteins of melanoma cells
   100173664 (GNB1)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100173664 (GNB1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A CALM_bind
Other DBs
NCBI-GeneID: 100173664
NCBI-ProteinID: NP_001126664
Ensembl: ENSPPYG00000001993
UniProt: Q5R5W8
LinkDB
Position
1
AA seq 340 aa
MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTF
TGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNA
FATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDAL
KADRAGVLAGHDDRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagtgagcttgaccagttacggcaggaggccgagcaacttaagaaccagattcgagac
gccaggaaagcatgtgcagatgcaactctctctcagatcacaaacaacatcgacccagtg
ggaagaatccagatgcgcacgaggaggacactgcgggggcacctggccaagatctatgcc
atgcactggggcacagactccaggcttctcgtcagtgcctcgcaggatggtaaacttatc
atctgggacagctacaccaccaacaaggtccacgccatccctctgcgctcctcctgggtc
atgacctgtgcatatgccccttctgggaactatgtggcctgtggtggcctggataacatt
tgctccatttacaatctgaaaactcgtgaagggaacgtgcgtgtgagtcgtgagctggca
ggacacacaggttacctgtcctgctgccgattcctggatgacaatcagatcgtcaccagc
tctggagacaccacatgtgccctgtgggacatcgagaccggccagcagacgaccacgttt
accggacacactggagatgtcatgagcctttctcttgctcctgacaccagactgttcgtc
tctggtgcttgtgatgcttcagccaaactctgggatgtgcgagaaggcatgtgccggcag
accttcaccggccacgagtccgacatcaatgccatttgcttctttccaaatggcaatgca
tttgccactggctcagacgatgccacctgcaggctgtttgaccttcgtgctgaccaggag
ctcatgacttactcccacgacaacatcatctgcgggatcacctctgtctccttctccaag
agcgggcgcctcctccttgctgggtacgatgacttcaactgcaacgtctgggacgcactc
aaagccgaccgggcaggtgtcttggctgggcatgacgaccgcgtcagctgcctgggtgtg
actgacgatggcatggctgtggcgacagggtcctgggatagcttcctcaagatctggaac
taa

KEGG   Pongo abelii (Sumatran orangutan): 100190818
Entry
100190818         CDS       T01416                                 

Gene name
GNG4
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 precursor
  KO
K04541  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100190818 (GNG4)
   04371 Apelin signaling pathway
    100190818 (GNG4)
   04151 PI3K-Akt signaling pathway
    100190818 (GNG4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100190818 (GNG4)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100190818 (GNG4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100190818 (GNG4)
   04727 GABAergic synapse
    100190818 (GNG4)
   04725 Cholinergic synapse
    100190818 (GNG4)
   04728 Dopaminergic synapse
    100190818 (GNG4)
   04726 Serotonergic synapse
    100190818 (GNG4)
   04723 Retrograde endocannabinoid signaling
    100190818 (GNG4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100190818 (GNG4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100190818 (GNG4)
  09165 Substance dependence
   05032 Morphine addiction
    100190818 (GNG4)
   05034 Alcoholism
    100190818 (GNG4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100190818 (GNG4)
   05163 Human cytomegalovirus infection
    100190818 (GNG4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100190818 (GNG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    100190818 (GNG4)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100190818 (GNG4)
SSDB
Motif
Pfam: G-gamma ATP-synt_F Adeno_PV
Other DBs
NCBI-GeneID: 100190818
NCBI-ProteinID: NP_001128978
UniProt: Q5R639 A0A2J8UE19
LinkDB
Position
1
AA seq 75 aa
MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA
SENPFREKKFFCTIL
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaaagagggcatgtctaataacagcaccactagcatctcccaagccaggaaagctgtg
gagcagctaaagatggaagcctgtatggacagggtcaaggtctcccaggcagctgcggac
ctcctggcctactgtgaagctcacgtgcgggaagaccctctcatcattccagtgcctgcg
tcagaaaacccctttcgcgagaagaagttcttttgtaccattctctaa

KEGG   Pongo abelii (Sumatran orangutan): 100433177
Entry
100433177         CDS       T01416                                 

Gene name
GNG10
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
  KO
K04545  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100433177 (GNG10)
   04371 Apelin signaling pathway
    100433177 (GNG10)
   04151 PI3K-Akt signaling pathway
    100433177 (GNG10)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100433177 (GNG10)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100433177 (GNG10)
  09156 Nervous system
   04724 Glutamatergic synapse
    100433177 (GNG10)
   04727 GABAergic synapse
    100433177 (GNG10)
   04725 Cholinergic synapse
    100433177 (GNG10)
   04728 Dopaminergic synapse
    100433177 (GNG10)
   04726 Serotonergic synapse
    100433177 (GNG10)
   04723 Retrograde endocannabinoid signaling
    100433177 (GNG10)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100433177 (GNG10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100433177 (GNG10)
  09165 Substance dependence
   05032 Morphine addiction
    100433177 (GNG10)
   05034 Alcoholism
    100433177 (GNG10)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100433177 (GNG10)
   05163 Human cytomegalovirus infection
    100433177 (GNG10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100433177 (GNG10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    100433177 (GNG10)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100433177 (GNG10)
SSDB
Motif
Pfam: G-gamma FtsX_ECD
Other DBs
NCBI-GeneID: 100433177
NCBI-ProteinID: XP_024107860
LinkDB
Position
9
AA seq 68 aa
MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFR
EPRSCALL
NT seq 207 nt   +upstreamnt  +downstreamnt
atgtcctccggggctagcgcgagcgccctgcagcgcttggtggagcagctcaagttggag
gctggcgtggagaggatcaaggtctcccaggcagctgcagagcttcaacagtactgtatg
cagaatgcctgcaaggatgccctgctggtgggtgttccagctggaagtaaccccttccgg
gagcccagatcctgtgctttactctga

KEGG   Pongo abelii (Sumatran orangutan): 100439475
Entry
100439475         CDS       T01416                                 

Gene name
GNG11
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11 isoform X2
  KO
K04546  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100439475 (GNG11)
   04371 Apelin signaling pathway
    100439475 (GNG11)
   04151 PI3K-Akt signaling pathway
    100439475 (GNG11)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100439475 (GNG11)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100439475 (GNG11)
  09156 Nervous system
   04724 Glutamatergic synapse
    100439475 (GNG11)
   04727 GABAergic synapse
    100439475 (GNG11)
   04725 Cholinergic synapse
    100439475 (GNG11)
   04728 Dopaminergic synapse
    100439475 (GNG11)
   04726 Serotonergic synapse
    100439475 (GNG11)
   04723 Retrograde endocannabinoid signaling
    100439475 (GNG11)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100439475 (GNG11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100439475 (GNG11)
  09165 Substance dependence
   05032 Morphine addiction
    100439475 (GNG11)
   05034 Alcoholism
    100439475 (GNG11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100439475 (GNG11)
   05163 Human cytomegalovirus infection
    100439475 (GNG11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100439475 (GNG11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    100439475 (GNG11)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100439475 (GNG11)
SSDB
Motif
Pfam: G-gamma DUF5660 HAUS5 DUF2508 COG2 Macoilin Cep57_CLD_2
Other DBs
NCBI-GeneID: 100439475
NCBI-ProteinID: XP_002818295
Ensembl: ENSPPYG00000017810
UniProt: H2PMW8 A0A663D7I0
LinkDB
Position
7
AA seq 73 aa
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
KNPFKEKGSCVIS
NT seq 222 nt   +upstreamnt  +downstreamnt
atgcctgcccttcacatcgaagatttgccagagaaggaaaaactgaaaatggaagttgag
cagcttcgcaaagaagtgaagttgcagagacaacaagtgtctaaatgttctgaagaaata
aagaactatattgaagaacgttctggagaggatcctctagtaaagggaattccagaagac
aagaacccctttaaagaaaaaggcagctgtgttatttcataa

KEGG   Pongo abelii (Sumatran orangutan): 100439849
Entry
100439849         CDS       T01416                                 

Gene name
GNGT1
Definition
(RefSeq) guanine nucleotide-binding protein G(T) subunit gamma-T1 isoform X3
  KO
K04548  guanine nucleotide-binding protein G(T) subunit gamma-T1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04744  Phototransduction
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100439849 (GNGT1)
   04371 Apelin signaling pathway
    100439849 (GNGT1)
   04151 PI3K-Akt signaling pathway
    100439849 (GNGT1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100439849 (GNGT1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100439849 (GNGT1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100439849 (GNGT1)
   04727 GABAergic synapse
    100439849 (GNGT1)
   04725 Cholinergic synapse
    100439849 (GNGT1)
   04728 Dopaminergic synapse
    100439849 (GNGT1)
   04726 Serotonergic synapse
    100439849 (GNGT1)
   04723 Retrograde endocannabinoid signaling
    100439849 (GNGT1)
  09157 Sensory system
   04744 Phototransduction
    100439849 (GNGT1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100439849 (GNGT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100439849 (GNGT1)
  09165 Substance dependence
   05032 Morphine addiction
    100439849 (GNGT1)
   05034 Alcoholism
    100439849 (GNGT1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100439849 (GNGT1)
   05163 Human cytomegalovirus infection
    100439849 (GNGT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100439849 (GNGT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    100439849 (GNGT1)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100439849 (GNGT1)
SSDB
Motif
Pfam: G-gamma DUF2508
Other DBs
NCBI-GeneID: 100439849
NCBI-ProteinID: XP_002818296
Ensembl: ENSPPYG00000017811
UniProt: A0A6D2WDH1 A0A2J8WJS9
LinkDB
Position
7
AA seq 74 aa
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED
KNPFKELKGGCVIS
NT seq 225 nt   +upstreamnt  +downstreamnt
atgccagtaatcaatattgaggacctgacagaaaaggacaaattgaagatggaagttgac
cagctcaagaaagaagtgacactggaaagaatgctagtttccaaatgttgtgaagaagta
agagattacgttgaagaacgatctggcgaggatccactggtaaagggcatcccagaggac
aaaaatcccttcaaggagctcaaaggaggctgtgtgatttcataa

KEGG   Pongo abelii (Sumatran orangutan): 100452739
Entry
100452739         CDS       T01416                                 

Gene name
GNGT2
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
  KO
K04549  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100452739 (GNGT2)
   04371 Apelin signaling pathway
    100452739 (GNGT2)
   04151 PI3K-Akt signaling pathway
    100452739 (GNGT2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100452739 (GNGT2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100452739 (GNGT2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100452739 (GNGT2)
   04727 GABAergic synapse
    100452739 (GNGT2)
   04725 Cholinergic synapse
    100452739 (GNGT2)
   04728 Dopaminergic synapse
    100452739 (GNGT2)
   04726 Serotonergic synapse
    100452739 (GNGT2)
   04723 Retrograde endocannabinoid signaling
    100452739 (GNGT2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100452739 (GNGT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452739 (GNGT2)
  09165 Substance dependence
   05032 Morphine addiction
    100452739 (GNGT2)
   05034 Alcoholism
    100452739 (GNGT2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100452739 (GNGT2)
   05163 Human cytomegalovirus infection
    100452739 (GNGT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100452739 (GNGT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    100452739 (GNGT2)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100452739 (GNGT2)
SSDB
Motif
Pfam: G-gamma Myc-LZ
Other DBs
NCBI-GeneID: 100452739
NCBI-ProteinID: XP_002834312
UniProt: A0A6D2XBD9 A0A2J8W936
LinkDB
Position
17
AA seq 69 aa
MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPF
KEKGGCLIS
NT seq 210 nt   +upstreamnt  +downstreamnt
atggcccaggatctcagcgagaaggacctgttgaagatggaggtggagcagctgaagaaa
gaagtgaaaaacacaagaattccgatttccaaagcgggaaaggaaatcaaggagtatgtg
gaagcccaagcaggaaacgacccttttctcaaaggcatccctgaggacaagaatcccttc
aaggagaaaggcggctgtctgataagctga

KEGG   Pongo abelii (Sumatran orangutan): 100453366
Entry
100453366         CDS       T01416                                 

Gene name
GNG3
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
  KO
K04540  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100453366 (GNG3)
   04371 Apelin signaling pathway
    100453366 (GNG3)
   04151 PI3K-Akt signaling pathway
    100453366 (GNG3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100453366 (GNG3)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100453366 (GNG3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100453366 (GNG3)
   04727 GABAergic synapse
    100453366 (GNG3)
   04725 Cholinergic synapse
    100453366 (GNG3)
   04728 Dopaminergic synapse
    100453366 (GNG3)
   04726 Serotonergic synapse
    100453366 (GNG3)
   04723 Retrograde endocannabinoid signaling
    100453366 (GNG3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100453366 (GNG3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100453366 (GNG3)
  09165 Substance dependence
   05032 Morphine addiction
    100453366 (GNG3)
   05034 Alcoholism
    100453366 (GNG3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100453366 (GNG3)
   05163 Human cytomegalovirus infection
    100453366 (GNG3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100453366 (GNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    100453366 (GNG3)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100453366 (GNG3)
SSDB
Motif
Pfam: G-gamma
Other DBs
NCBI-GeneID: 100453366
NCBI-ProteinID: XP_002821694
Ensembl: ENSPPYG00000003150
UniProt: H2ND45 A0A6D2VZU6
LinkDB
Position
11
AA seq 75 aa
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT
SENPFREKKFFCALL
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaaaggtgagaccccggtgaacagcactatgagtattgggcaagcacgcaaaatggtg
gaacagcttaagattgaagccagcttgtgtcggataaaggtgtccaaggcagcagcagac
ctgatgacctactgtgatgcccacgcctgtgaggatcccctcatcacccctgtgcccact
tcggagaaccccttccgggagaagaagttcttctgtgctctcctctga

KEGG   Pongo abelii (Sumatran orangutan): 100453483
Entry
100453483         CDS       T01416                                 

Gene name
GNB3
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 isoform X2
  KO
K07825  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04742  Taste transduction
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100453483 (GNB3)
   04371 Apelin signaling pathway
    100453483 (GNB3)
   04151 PI3K-Akt signaling pathway
    100453483 (GNB3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100453483 (GNB3)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100453483 (GNB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100453483 (GNB3)
   04727 GABAergic synapse
    100453483 (GNB3)
   04725 Cholinergic synapse
    100453483 (GNB3)
   04728 Dopaminergic synapse
    100453483 (GNB3)
   04726 Serotonergic synapse
    100453483 (GNB3)
   04723 Retrograde endocannabinoid signaling
    100453483 (GNB3)
  09157 Sensory system
   04742 Taste transduction
    100453483 (GNB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100453483 (GNB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100453483 (GNB3)
  09165 Substance dependence
   05032 Morphine addiction
    100453483 (GNB3)
   05034 Alcoholism
    100453483 (GNB3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100453483 (GNB3)
   05163 Human cytomegalovirus infection
    100453483 (GNB3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100453483 (GNB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100453483 (GNB3)
   04031 GTP-binding proteins [BR:pon04031]
    100453483 (GNB3)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100453483 (GNB3)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100453483 (GNB3)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A WD40_like Cytochrom_D1
Other DBs
NCBI-GeneID: 100453483
NCBI-ProteinID: XP_002822884
Ensembl: ENSPPYG00000004204
UniProt: H2NGA0 A0A6D2W763
LinkDB
Position
12
AA seq 340 aa
MGEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRIQMRTRRTLRGHLAKIYA
MHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNM
CSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVF
VGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPSGEA
ICTGSDDASCRLFDLRADQELICFSHESIICGITSVAFSLSGRLLFAGYDDFNCNVWDSM
KSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgggggagatggagcaactgcgtcaggaagcggagcagctcaagaagcagattgcagat
gccaggaaagcctgtgctgacgttactctggcagagctggtgtctggcctagaggtggtg
ggacgaatccagatgcggacgcggcggacgttaagggggcacctggccaagatctacgcc
atgcactgggccactgattctaagctgctggtaagtgcctcgcaagatgggaagctgatc
gtgtgggacagctacaccaccaacaaggtgcacgccatcccactgcgctcctcctgggtc
atgacctgtgcctatgccccatcagggaactttgtggcatgtggggggctggacaacatg
tgttccatctacaacctcaaatcccgtgagggcaatgtcaaggtcagccgggagctttct
gctcacacaggttatctctcctgctgccgctttctggatgacaacaatattgtgaccagc
tcaggggacaccacgtgtgccttgtgggacattgagactgggcagcagaagactgtgttc
gtgggacacacgggtgactgcatgagcctggctgtgtctcctgacttcaatctcttcatt
tcgggggcctgtgatgccagcgccaagctctgggatgtgcgagaggggacctgccgtcag
actttcactggccacgagtctgacatcaatgccatctgtttcttccccagtggagaggcc
atctgcacgggctcggatgatgcttcctgccgcttgtttgacctgcgggcagaccaggag
ctgatctgcttctcccacgagagcatcatctgcggcatcacgtccgtggccttctccctc
agtggccgcctgctattcgctggctacgacgacttcaactgcaatgtctgggactccatg
aagtctgagcgtgtgggcatcctctctggccacgataacagggtcagctgcctgggagtc
acagctgatgggatggctgtggccacaggttcctgggacagcttcctcaaaatctggaac
tga

KEGG   Pongo abelii (Sumatran orangutan): 100455858
Entry
100455858         CDS       T01416                                 

Gene name
GNB4
Definition
(RefSeq) guanine nucleotide-binding protein subunit beta-4
  KO
K04538  guanine nucleotide-binding protein subunit beta-4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100455858 (GNB4)
   04371 Apelin signaling pathway
    100455858 (GNB4)
   04151 PI3K-Akt signaling pathway
    100455858 (GNB4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100455858 (GNB4)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100455858 (GNB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100455858 (GNB4)
   04727 GABAergic synapse
    100455858 (GNB4)
   04725 Cholinergic synapse
    100455858 (GNB4)
   04728 Dopaminergic synapse
    100455858 (GNB4)
   04726 Serotonergic synapse
    100455858 (GNB4)
   04723 Retrograde endocannabinoid signaling
    100455858 (GNB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100455858 (GNB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100455858 (GNB4)
  09165 Substance dependence
   05032 Morphine addiction
    100455858 (GNB4)
   05034 Alcoholism
    100455858 (GNB4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100455858 (GNB4)
   05163 Human cytomegalovirus infection
    100455858 (GNB4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100455858 (GNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100455858 (GNB4)
   04031 GTP-binding proteins [BR:pon04031]
    100455858 (GNB4)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100455858 (GNB4)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100455858 (GNB4)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A WD40_like
Other DBs
NCBI-GeneID: 100455858
NCBI-ProteinID: XP_003776409
LinkDB
Position
3
AA seq 340 aa
MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYA
MHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDSQIVTSSGDTTCALWDIETAQQTTTF
TGHSGDVMSLSLSPDMRTFVSGACDASSKLWDIRDGMCRQSFTGHVSDINAVSFFPNGYA
FATGSDDATCRLFDLRADQELSLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTL
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagcgaactggaacagttgaggcaagaagcagaacaactgcggaatcagattcaggat
gctcggaaagcatgtaatgatgcaacgcttgttcagattacatcaaatatggactccgtg
ggtcgaatacaaatgcgaacaagacgtacactgaggggccacctagctaaaatctatgct
atgcattggggatatgattccaggctgctagtcagtgcttcccaagatggaaaattaatt
atttgggatagctatacaacaaataagatgcatgctattcctttgaggtcctcctgggtg
atgacttgtgcttatgctccctctggtaattatgttgcctgtggaggcttggacaacatc
tgctctatatataacttaaagaccagagagggaaatgtgagagtaagccgagagttgcca
ggtcacacagggtacttgtcctgctgtcgttttttagatgacagccaaattgttacaagt
tcaggagatacaacttgtgctttatgggacatcgaaactgcccagcagaccaccacattc
actgggcattctggagatgtgatgagtctttctctgagtcctgacatgaggacttttgtt
tctggtgcttgtgatgcttcttccaaattatgggacattcgagatggaatgtgtagacag
tctttcacgggacatgtctcagatattaatgctgtcagttttttcccaaatggatatgcc
ttcgccactggctctgatgatgccacttgccggctctttgaccttcgtgcagatcaagag
ttatcattgtattctcatgacaatatcatctgtggaatcacttccgtagccttctcaaaa
agtgggcgtctcttgttggctggttacgatgactttaattgtaacgtatgggacacgcta
aaaggagatcgtgcaggtgtccttgctggtcatgacaaccgtgtgagctgcttaggtgta
actgatgatggcatggctgtggcaacaggctcttgggacagttttcttagaatctggaat
taa

KEGG   Pongo abelii (Sumatran orangutan): 100458183
Entry
100458183         CDS       T01416                                 

Gene name
GNB2
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 isoform X1
  KO
K04537  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100458183 (GNB2)
   04371 Apelin signaling pathway
    100458183 (GNB2)
   04151 PI3K-Akt signaling pathway
    100458183 (GNB2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100458183 (GNB2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100458183 (GNB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100458183 (GNB2)
   04727 GABAergic synapse
    100458183 (GNB2)
   04725 Cholinergic synapse
    100458183 (GNB2)
   04728 Dopaminergic synapse
    100458183 (GNB2)
   04726 Serotonergic synapse
    100458183 (GNB2)
   04723 Retrograde endocannabinoid signaling
    100458183 (GNB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100458183 (GNB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458183 (GNB2)
  09165 Substance dependence
   05032 Morphine addiction
    100458183 (GNB2)
   05034 Alcoholism
    100458183 (GNB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100458183 (GNB2)
   05163 Human cytomegalovirus infection
    100458183 (GNB2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100458183 (GNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100458183 (GNB2)
   04031 GTP-binding proteins [BR:pon04031]
    100458183 (GNB2)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100458183 (GNB2)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100458183 (GNB2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like CALM_bind
Other DBs
NCBI-GeneID: 100458183
NCBI-ProteinID: XP_024105663
LinkDB
Position
7
AA seq 391 aa
MRPPSDSGVSVWLKAGHTGLFSLGPAARSCLPQPPSRGPQPPPTPPHGPGAMSELEQLRQ
EAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRL
LVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTR
EGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMS
LSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDAT
CRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLA
GHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgaggcccccatctgattctggagtcagtgtctggctgaaagctgggcatacaggacta
ttcagcctcgggccagcggccaggagctgcctcccccagcccccgtcccgcggcccccag
ccgcccccaaccccgccccacgggcccggcgccatgagtgagctggagcaactgagacag
gaggccgagcagctccggaaccagatccgggatgcccgaaaagcatgtggggactcaaca
ctgacccagatcacagctgggctggacccagtggggagaatccagatgaggactcggagg
accctccgtgggcacctggcaaagatctatgccatgcactgggggaccgactcaaggctg
ctggtcagcgcctcccaggatgggaagctcatcatctgggacagctacaccaccaacaag
gttcacgccatcccgctgcgctcctcttgggtcatgacctgtgcctacgcgccctcaggg
aactttgtggcctgtggggggttggacaacatctgctccatctacagcctcaagacccgc
gagggcaacgtcagggtcagccgggagctgcctggccacactgggtacctgtcgtgttgc
cgcttcctggatgacaaccaaatcatcaccagctctggggataccacctgtgccctgtgg
gacattgagacaggccagcagacagtgggttttgctggacacagtggggatgtgatgtcc
ctgtccctggcccccgatggccgcacgtttgtgtcaggcgcctgtgatgcctctatcaag
ctgtgggatgtgcgggattccatgtgccgacagaccttcatcggccacgaatctgacatc
aatgcagtggctttcttccccaacggctacgccttcaccaccggctctgacgacgccacg
tgccgcctcttcgacctgcgggccgatcaggagctcctcatgtactcgcatgacaacatc
atctgtggcatcacctctgttgccttctcgcgcagcggccggctgctgctcgctggctat
gacgacttcaactgcaacatctgggatgccatgaagggcgaccgtgcaggggtcctcgct
ggccacgacaaccgcgtgagctgcctcggggtcaccgacgatggcatggctgtggccacg
ggctcctgggactccttcctcaagatctggaactaa

KEGG   Pongo abelii (Sumatran orangutan): 112129369
Entry
112129369         CDS       T01416                                 

Gene name
GNG13
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
  KO
K04547  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04742  Taste transduction
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    112129369 (GNG13)
   04371 Apelin signaling pathway
    112129369 (GNG13)
   04151 PI3K-Akt signaling pathway
    112129369 (GNG13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    112129369 (GNG13)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112129369 (GNG13)
  09156 Nervous system
   04724 Glutamatergic synapse
    112129369 (GNG13)
   04727 GABAergic synapse
    112129369 (GNG13)
   04725 Cholinergic synapse
    112129369 (GNG13)
   04728 Dopaminergic synapse
    112129369 (GNG13)
   04726 Serotonergic synapse
    112129369 (GNG13)
   04723 Retrograde endocannabinoid signaling
    112129369 (GNG13)
  09157 Sensory system
   04740 Olfactory transduction
    112129369 (GNG13)
   04742 Taste transduction
    112129369 (GNG13)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112129369 (GNG13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112129369 (GNG13)
  09165 Substance dependence
   05032 Morphine addiction
    112129369 (GNG13)
   05034 Alcoholism
    112129369 (GNG13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112129369 (GNG13)
   05163 Human cytomegalovirus infection
    112129369 (GNG13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112129369 (GNG13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    112129369 (GNG13)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    112129369 (GNG13)
SSDB
Motif
Pfam: G-gamma
Other DBs
NCBI-GeneID: 112129369
NCBI-ProteinID: XP_024089103
LinkDB
Position
16
AA seq 67 aa
MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KGKCAIL
NT seq 204 nt   +upstreamnt  +downstreamnt
atggaggaatgggacgtgccacagatgaagaaagaggtggagagcctcaagtaccagctg
gccttccagcgggagatggcgtccaagaccatccctgagctgctgaagtggatcgaggat
gggatccccaaggaccccttcctgaaccccgacctgatgaagaacaacccatgggtggaa
aagggcaaatgcgccatcctgtga

KEGG   Pongo abelii (Sumatran orangutan): 112130221
Entry
112130221         CDS       T01416                                 

Gene name
GNG8
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8
  KO
K04544  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    112130221 (GNG8)
   04371 Apelin signaling pathway
    112130221 (GNG8)
   04151 PI3K-Akt signaling pathway
    112130221 (GNG8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    112130221 (GNG8)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112130221 (GNG8)
  09156 Nervous system
   04724 Glutamatergic synapse
    112130221 (GNG8)
   04727 GABAergic synapse
    112130221 (GNG8)
   04725 Cholinergic synapse
    112130221 (GNG8)
   04728 Dopaminergic synapse
    112130221 (GNG8)
   04726 Serotonergic synapse
    112130221 (GNG8)
   04723 Retrograde endocannabinoid signaling
    112130221 (GNG8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112130221 (GNG8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112130221 (GNG8)
  09165 Substance dependence
   05032 Morphine addiction
    112130221 (GNG8)
   05034 Alcoholism
    112130221 (GNG8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112130221 (GNG8)
   05163 Human cytomegalovirus infection
    112130221 (GNG8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112130221 (GNG8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pon04031]
    112130221 (GNG8)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    112130221 (GNG8)
SSDB
Motif
Pfam: G-gamma Flexi_CP
Other DBs
NCBI-GeneID: 112130221
NCBI-ProteinID: XP_024094021
LinkDB
Position
19
AA seq 70 aa
MSNNMAKIAEARKTVEQLKLEVNIDRMKVSQAAAELLAFCETHAKDDPLVTPVPAAENPF
RDKRLFCVLL
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtccaacaacatggccaagattgccgaggcccgcaagacggtggaacagctgaagctg
gaggtgaacatcgaccgcatgaaggtgtcgcaggcagcagccgaactcctggctttctgc
gagacgcatgccaaagatgacccgctggtgacgccagtacccgccgcggagaaccccttc
cgcgacaagcgcctcttttgtgttctgctctga

KEGG   Pongo abelii (Sumatran orangutan): 112130240
Entry
112130240         CDS       T01416                                 

Gene name
GNG14
Definition
(RefSeq) LOW QUALITY PROTEIN: putative guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-14
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04371  Apelin signaling pathway
pon04713  Circadian entrainment
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04727  GABAergic synapse
pon04728  Dopaminergic synapse
pon04810  Regulation of actin cytoskeleton
pon04926  Relaxin signaling pathway
pon05032  Morphine addiction
pon05034  Alcoholism
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112130240 (GNG14)
   04014 Ras signaling pathway
    112130240 (GNG14)
   04371 Apelin signaling pathway
    112130240 (GNG14)
   04151 PI3K-Akt signaling pathway
    112130240 (GNG14)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112130240 (GNG14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    112130240 (GNG14)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112130240 (GNG14)
  09156 Nervous system
   04724 Glutamatergic synapse
    112130240 (GNG14)
   04727 GABAergic synapse
    112130240 (GNG14)
   04725 Cholinergic synapse
    112130240 (GNG14)
   04728 Dopaminergic synapse
    112130240 (GNG14)
   04726 Serotonergic synapse
    112130240 (GNG14)
   04723 Retrograde endocannabinoid signaling
    112130240 (GNG14)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112130240 (GNG14)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112130240 (GNG14)
  09165 Substance dependence
   05032 Morphine addiction
    112130240 (GNG14)
   05034 Alcoholism
    112130240 (GNG14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112130240 (GNG14)
   05163 Human cytomegalovirus infection
    112130240 (GNG14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112130240 (GNG14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    112130240 (GNG14)
   04031 GTP-binding proteins [BR:pon04031]
    112130240 (GNG14)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112130240 (GNG14)
  Exosomal proteins of colorectal cancer cells
   112130240 (GNG14)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    112130240 (GNG14)
SSDB
Motif
Pfam: G-gamma
Other DBs
NCBI-GeneID: 112130240
NCBI-ProteinID: XP_024094167
LinkDB
Position
19
AA seq 107 aa
MSSKVAINSDIGQGLXAVEQLQMEAGIEQVKVRVGASAGGRKRWEHMGQGTGACLGLVWL
TQLVCRCPXMAADLLQFCTEQAKNDHFLVGIPAATNSFKEKKPYAIL
NT seq 324 nt   +upstreamnt  +downstreamnt
atgtccagcaaggtggccatcaacagtgacattgggcagggcctctgagcagtggagcag
ctccagatggaggcaggcatcgagcaagtgaaggtgagagtcggggccagtgcaggaggc
aggaagaggtgggaacacatgggccaggggacaggtgcatgcctgggtctggtctggctg
acccagttggtctgcaggtgtccanagatggccgccgatctgctgcagttctgcacggag
caggccaagaacgaccacttccttgtgggcatcccagccgccaccaactccttcaaggag
aagaagccctatgccatcctatga

DBGET integrated database retrieval system