KEGG   Pongo abelii (Sumatran orangutan): 100171723
Entry
100171723         CDS       T01416                                 

Gene name
VAV2
Definition
(RefSeq) guanine nucleotide exchange factor VAV2
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04510  Focal adhesion
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05135  Yersinia infection
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100171723 (VAV2)
   04024 cAMP signaling pathway
    100171723 (VAV2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100171723 (VAV2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100171723 (VAV2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100171723 (VAV2)
   04660 T cell receptor signaling pathway
    100171723 (VAV2)
   04662 B cell receptor signaling pathway
    100171723 (VAV2)
   04664 Fc epsilon RI signaling pathway
    100171723 (VAV2)
   04666 Fc gamma R-mediated phagocytosis
    100171723 (VAV2)
   04670 Leukocyte transendothelial migration
    100171723 (VAV2)
   04062 Chemokine signaling pathway
    100171723 (VAV2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100171723 (VAV2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100171723 (VAV2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100171723 (VAV2)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100171723 (VAV2)
SSDB
Motif
Pfam: RhoGEF CAMSAP_CH SH3_2 CH SH3_1 SH3_9 SH2 PH C1_1 CDC24 PH_10 PH_16
Other DBs
NCBI-GeneID: 100171723
NCBI-ProteinID: NP_001124861
Ensembl: ENSPPYG00000019744
UniProt: Q5REF3
LinkDB
Position
9
AA seq 839 aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLE
DLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLICGEYCSHMEHAQNTLNQLLASRE
DFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLKEALEV
MQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDR
YLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGF
QFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQ
GYMCTKCGVGAYKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLT
FQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTA
YPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIH
ITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPVFTPRVIG
TAVARYNFAARDMRELSLREGDVVGIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
NT seq 2520 nt   +upstreamnt  +downstreamnt
atggagcagtggcggcagtgcggccgctggctcatcgactgcaaggtcctgccgcccaac
caccgggtggtttggccctcggccgtggtcttcgacctggcgcaggcgctgcgcgacggg
gtccttctgtgccagctgctgcacaacctctcccccggctccatcgacctcaaggacatc
aacttccggccgcagatgtcccagttcctgtgtttgaagaacatacgcaccttcctgaaa
gtctgccacgataaattcggattaaggaacagcgagctgtttgacccctttgacctcttc
gatgtgcgagactttggaaaggtcatctccgcggtgtcgaggctctccctgcacagcatt
gcgcagaacaaagggatcaggccttttccctcagaggagaccgcagagaatgacgatgac
gtctaccgcagcctggaggagctggccgacgagcatgatctgggggaggacatctacgac
tgcgtcccgtgtgaggatggaggggacgacatctatgaggacatcatcaaggtggaggtg
cagcagcccatgaaaatgggcatgactgaggatgacaagaggaactgctgcctgctggag
atccaggagaccgaggccaagtactaccgcaccctggaggacatcgagaagaactacatg
agccccctgcggctggtgctgagcccggcggacatggcggctgtcttcattaacctggag
gacctgatcaaggtgcatcacagcttcctgagggccattgacgtgtccgtgatggtgggg
ggcagcacgctggccaaggtcttcctcgacttcaaggaaaggctcctgatctgcggggag
tactgcagccacatggagcacgcccagaacacgctgaaccagctcctggccagccgggag
gacttcaggcagaaagtcgaggagtgcacgctgaaggtccaggatggaaaatttaagctg
caagacctgctggtggtccccatgcagagggtgctcaaataccacctgctcttgaaggag
cttctgagccattccgcggaacggcctgagaggcagcagctcaaagaagcactggaagtt
atgcaggacttggcgatgtacatcaatgaagttaaacgggacaaggagaccttgaggaaa
atcagtgaatttcagagttctatagaaaatttgcaagtgaaactggaggaatttggaaga
ccaaaaattgatggggaactgaaagtccggtccatagtcaaccacaccaagcaggacagg
tacttgttcctgtttgacaaggtggtcatcgtctgtaagcggaagggctacagctacgag
ctcaaggagatcatagagctgctcttccacaagatgaccgacgaccccatgaacaacaag
gacgtcaagaagtggtcctacggcttctacctaattcaccttcaaggaaagcagggcttc
cagtttttctgcaaaacagaagatatgaagaggaagtggatggagcagtttgagatggcc
atgtcaaacatcaagccagacaaagccaatgccaaccaccacagtttccagatgtacacg
tttgacaagaccaccaactgcaaagcctgcaaaatgttcctcaggggcaccttctaccag
ggatacatgtgtaccaagtgcggcgtcggggcatacaaggagtgcctggaagtgatacct
ccctgcaagttcacttctcctgcagatctggacgcctccggagcgggaccaggtcccaag
atggtggccatgcagaattaccatggcaacccagctcctcccgggaagcctgtgctgacc
ttccagacaggcgacgtgcttgagctgctgaggggcgaccctgagtctccgtggtgggag
ggtcgtctggtgcaaaccaggaagtcagggtatttccccagctcatctgtgaagccctgc
cctgtggatggaaggccgcccatcagccggccgccatcccgggagatcgactacactgca
tacccctggtttgcaggtaacatggagaggcagcagacggacaacctgctcaagtcccac
gccagtgggacctacctgatcagggagcggcctgccgaggctgagcgctttgcaataagc
atcaagttcaacgatgaggtgaagcacatcaaggtggtggagaaggacaactggatccac
atcacagaggccaagaaattcgacagcctcctggagttggtggagtactaccagtgccac
tcactcaaggagagcttcaagcagctggataccacactcaagtacccctacaagtcccgg
gaacgttcggcctccagggcctccagccggtccccagtgttcacgccccgcgtcatcggc
acggctgtggccaggtacaactttgccgcccgagacatgagggagctttcacttcgggag
ggtgacgtggtggggatctacagccgcattggcggagaccagggctggtggaagggcgag
accaatggacggattggctggtttccttcaacgtacgtagaagaggagggcatccagtga

KEGG   Pongo abelii (Sumatran orangutan): 100442703
Entry
100442703         CDS       T01416                                 

Gene name
VAV3
Definition
(RefSeq) guanine nucleotide exchange factor VAV3
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04510  Focal adhesion
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05135  Yersinia infection
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100442703 (VAV3)
   04024 cAMP signaling pathway
    100442703 (VAV3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100442703 (VAV3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100442703 (VAV3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100442703 (VAV3)
   04660 T cell receptor signaling pathway
    100442703 (VAV3)
   04662 B cell receptor signaling pathway
    100442703 (VAV3)
   04664 Fc epsilon RI signaling pathway
    100442703 (VAV3)
   04666 Fc gamma R-mediated phagocytosis
    100442703 (VAV3)
   04670 Leukocyte transendothelial migration
    100442703 (VAV3)
   04062 Chemokine signaling pathway
    100442703 (VAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100442703 (VAV3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100442703 (VAV3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100442703 (VAV3)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100442703 (VAV3)
SSDB
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_9 SH3_1 SH2 C1_1 PH CDC24 Filamin PH_16 PH_10 LZ3wCH Prok-RING_1 Zn_ribbon_17 C1_2 zf-RING-like
Other DBs
NCBI-GeneID: 100442703
NCBI-ProteinID: XP_024091398
Ensembl: ENSPPYG00000001098
LinkDB
Position
1
AA seq 847 aa
MEPWKQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESINDEDIYKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVI
RNYSGTPPPALHEGPPLHLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRA
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
NT seq 2544 nt   +upstreamnt  +downstreamnt
atggagccgtggaagcagtgcgcgcagtggctcatccattgcaaggtgctgcccgccaac
caccgggtgacttgggactcggctcaggtgttcgacctggcgcagaccctccgcgatgga
gtcctgctctgccagctgcttaacaacctccgggcgcactccatcaacctgaaggagatc
aacctgaggccacagatgtcccagtttctctgtttgaagaacataaggacatttctcacg
gcctgttgtgagacgtttggaatgaggaaaagtgaacttttcgaggcatttgacctgttt
gatgttcgtgactttggaaaggttatagaaacattatcacgactttctcgaacacctata
gcgttggccacaggaatcaggcccttcccaacagaagaaagcattaatgatgaagacatc
tacaaaggccttcctgatttaatagatgaaacccttgtggaagatgaagaagatctctat
gactgtgtttatggggaagatgaaggtggagaagtctatgaggacttaatgaaggcagag
gaagcacatcagcccaaatgtccagaaaatgatatacgaagttgttgtctagcagaaatt
aagcagacagaagaaaaatatacagaaactttggagtcaatagaaaaatatttcatggca
ccactaaaaagatttctgacagcagcagaatttgattcagtattcatcaacattcctgaa
cttgtaaaacttcatcggaacctaatgcaagagattcatgattccattgtaaataaaaat
gaccagaacttgtaccaagtttttattaactacaaggaaagattggttatttacgggcag
tactgcagtggagtggagtcagccatctctagtttagactacatttctaagacaaaagaa
gatgtcaaactgaaattagaggaatgttccaaaagagcaaataatgggaaatttactctt
cgagacttgcttgtggttcctatgcaacgtgttttaaagtaccaccttctcctccaggaa
ctggtcaaacataccactgatccgactgagaaggcaaatctgaaactggctcttgatgcc
atgaaggacttggcacaatatgtgaatgaagtgaaaagagataatgagacccttcgtgaa
attaaacagtttcagctatctatagagaatttgaaccaaccagttttgctttttggacga
cctcagggagatggtgaaattcgaataaccactctagacaagcataccaaacaagaaagg
catatcttcttatttgatttggcagtgatcgtatgtaagagaaaaggtgataactatgaa
atgaaggaaataatagatcttcagcagtacaagatagccaataatcctacaaccgataaa
gaaaataaaaagtggtcttatggcttctacctcatccatacccaaggacaaaatgggtta
gaattttattgcaaaacaaaagatttaaagaagaaatggctagaacagtttgaaatggct
ttgtctaacataaggccagactacgcagactccaatttccacgacttcaagatgcacacc
ttcactcgagtcacatcctgcaaagtctgccagatgctcctgaggggaacattttatcaa
ggctatttatgttttaagtgtggagcgagagcacacaaagaatgtttgggaagagtagac
aattgtggcagagttaattctggtgaacaagggacactcaaactaccagagaaacggacc
aatggactgcgaagaactcctaaacaggtggatccaggtttaccaaagatgcaggtcatt
aggaactattctggaacaccacccccagctctgcatgaaggaccccctttacacctccag
gccggggatacggttgaacttctgaaaggagatgcacacagtctgttttggcagggcaga
aatttagcatctggagaggttggattttttccaagtgatgcagtcaagccttgcccatgt
gtgcccaaaccagtagattattcttgccaaccctggtatgctggagcaatggaaagattg
caagcagagactgaacttattaatagggtaaatagtacttaccttgtgaggcacaggacc
aaagagtcaggagaatatgcaattagcattaagtacaataatgaagcaaagcacatcaag
attttaacaagagatggcttttttcacattgcagaaaatagaaaatttaaaagtttaatg
gaacttgtggagtactacaagcatcattctctcaaggaagggttcagaaccttagataca
actctgcagtttccatacaaggagccagaacattcagctggacagaggggtaatagagca
ggcaacagcttgttaagtccaaaagtgctgggcattgccatcgctcggtatgacttctgt
gcaagagatatgagagagttgtccttgttgaaaggagatgtggtgaagatttacacaaag
atgagtgcaaatggctggtggagaggagaagtaaacggcagggtgggatggtttccatcc
acgtatgtggaagaggatgaataa

KEGG   Pongo abelii (Sumatran orangutan): 100447155
Entry
100447155         CDS       T01416                                 

Gene name
VAV1
Definition
(RefSeq) proto-oncogene vav isoform X1
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04510  Focal adhesion
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05135  Yersinia infection
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100447155 (VAV1)
   04024 cAMP signaling pathway
    100447155 (VAV1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100447155 (VAV1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100447155 (VAV1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100447155 (VAV1)
   04660 T cell receptor signaling pathway
    100447155 (VAV1)
   04662 B cell receptor signaling pathway
    100447155 (VAV1)
   04664 Fc epsilon RI signaling pathway
    100447155 (VAV1)
   04666 Fc gamma R-mediated phagocytosis
    100447155 (VAV1)
   04670 Leukocyte transendothelial migration
    100447155 (VAV1)
   04062 Chemokine signaling pathway
    100447155 (VAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100447155 (VAV1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100447155 (VAV1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100447155 (VAV1)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100447155 (VAV1)
SSDB
Motif
Pfam: RhoGEF SH3_1 SH3_2 CAMSAP_CH CH SH2 SH3_9 C1_1 PH CDC24 C1_2 DUF3104 LZ3wCH PH_16
Other DBs
NCBI-GeneID: 100447155
NCBI-ProteinID: XP_024092799
Ensembl: ENSPPYG00000009465
LinkDB
Position
19
AA seq 845 aa
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQIRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRAPAHKECLGRVPPCGRLGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISKPAVGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED
YSEYC
NT seq 2538 nt   +upstreamnt  +downstreamnt
atggagctgtggcgccagtgcacccactggctcatccagtgccgggtgctgccgcccagc
caccgtgtgacctgggatggggctcaggtgtgtgaactggcccaggccctccgggatggt
gtccttctgtgtcagctgcttaacaacctgctaccccatgccatcaacctgcgtgaggtc
aacctgcgcccccagatgtcccagttcctgtgccttaagaacattagaaccttcctgtcc
acctgctgtgagaagttcggcctcaagcggagcgagctctttgaagcctttgacctcttc
gatgtgcaggattttggcaaggtcatctacaccctgtctgctctgtcctggaccccgatt
gcccagaacagggggatcatgcccttccccaccgaggaggagagtgtaggtgatgaagac
atctacagtggcctgtccgaccagatcgacgacacggtggaggaggatgaggacctgtat
gactgcgtggagaatgaggaggcggaaggcgacgagatctatgaggacctcatgcgctcg
gagcccgtgtccatgccgcccaagatgacagagtatgataagcgctgctgctgcctgcgg
gagatccagcagacggaggagaagtacacggacacgctgggctccatccagcagcatttc
ttgaagcccctgcaacggttcctgaaacctcaagacattgagatcatctttatcaacatt
gaggacctgcttcgtgttcatactcacttcctaaaggagatgaaggaagccctgggcacc
cctggcgcagccaatctctaccaggtcttcatcaaatacaaggagaggtttctcgtctat
ggccgctactgcagccaggtggagtcagccagcaaacacctggaccgtgtggccgcagcc
cgggaggacgtgcagatgaagctggaggaatgttctcagagagccaacaacgggaggttc
accctgcgggacctgctgatggtgcctatgcagcgagttctcaaatatcacctccttctc
caggagctggtgaaacacacgcaggaggcgatggagaaggagaacctgcggctggccctg
gatgccatgagggacctggctcagtgcgtgaacgaggtcaagcgagacaacgagacactg
cggcagatcaccaatttccagctgtccattgagaacctggaccagtctttggctcactat
ggccggcccaagatagacggggagctcaagatcacctcggtggaacggcgctccaagatg
gacaggtacgccttcctgctcgacaaagctctactcatctgtaagcgccggggagactcc
tatgacctcaaggactttgtgaacctgcacagcttccagattcgggatgactcttcagga
gaccgagacaacaagaagtggagccacatgttcctcctgatcgaggaccaaggtgcccag
ggctatgagctgttcttcaagacaagagaattgaagaagaagtggatggagcagtttgag
atggccatctccaacatctacccggagaatgccactgccaatgggcatgacttccagatg
ttctcctttgaggagaccacatcctgcaaagcctgtcagatgctgcttagaggtaccttc
tatcagggctaccgctgccatcggtgccgggcacctgcacacaaggagtgtctggggagg
gtccctccatgtggccgacttgggcaagatttcccaggaactatgaagaaggacaaacta
catcgcagggctcaggacaaaaagaggaatgagctgggtctgcccaagatggaggtgttt
caggaatactacgggcttcctccaccccctggagccattggacccttcctacggctcaac
cctggagacattgtggagctcacgaaggctgaggctgaacagaactggtgggagggcagg
aatacatctactaatgaaattggctggtttccttgtaacagggtgaagccctacgtccat
ggccctcctcaggacctgtctgttcatctctggtacgcaggccccatggagcgagcaggg
gcagagagcatcctggccaaccgctcggacgggactttcttggtgcggcagagagtgaag
gatgcagcagaatttgccatcagcattaaatacaacgtcgaggtcaagcacattaaaatc
atgacagcagaaggactgtaccggatcacagagaaaaaggctttccgggggcttacggag
ctggtggagttttaccagcagaactccctaaaggattgcttcaagtctctggacaccacc
ttgcagttccccttcaaggagcctgagaagaggaccatcagcaagccagcagtgggaagc
acaaagtattttggcacagccaaagcccgctatgacttctgcgctcgagaccgatcagag
ctgtcgctcaaggagggtgacatcatcaagatccttaacaagaagggacagcaaggctgg
tggcgaggggagatctatggccgggttggctggttccctgccaactacgtggaggaagat
tattctgaatactgctga

DBGET integrated database retrieval system