KEGG   Pongo abelii (Sumatran orangutan): 100171824
Entry
100171824         CDS       T01416                                 

Gene name
SGK2
Definition
(RefSeq) serine/threonine-protein kinase Sgk2
  KO
K13303  serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04068  FoxO signaling pathway
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100171824 (SGK2)
   04151 PI3K-Akt signaling pathway
    100171824 (SGK2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100171824 (SGK2)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   100171824 (SGK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Kdo
Other DBs
NCBI-GeneID: 100171824
NCBI-ProteinID: NP_001124952
Ensembl: ENSPPYG00000011020
UniProt: Q5RDZ9
LinkDB
Position
20
AA seq 367 aa
MNSSPAGTPSPQPSRANGNINLGPSANPNARPTDFDFLKVIGKGNYGKVLLAKRKSDGTF
YAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVDGGE
LFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGL
CKEGVEPEETTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVS
QMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDL
YHKRLTPPFNPNVAGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPE
DDDILDC
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgaactctagcccagctgggacccccagtccacagccctccagggccaatgggaacatc
aacctggggccttcagccaacccaaatgcccggcccacggacttcgacttcctcaaagtc
attggcaaagggaactacgggaaggtcctactggccaagcgcaagtctgatgggacgttc
tatgcagtgaaggtgctgcagaaaaagtccatcttaaagaagaaagagcagagccacatc
atggcagaacgcagtgtgcttctgaagaatgtgcggcaccccttcctcgtgggcctgcgc
tactccttccagacacctgagaagctctacttcgtgctcgactatgtcgacgggggtgag
ctcttcttccacctgcagcgggagcgccggttcctggagccccgggccaggttctacgct
gctgaggtggccagcgccattggctacctgcactccctcaacatcatttacagggacctg
aaaccagagaacattctcttggactgccagggacacgtggtgctgacggattttggcctc
tgcaaggaaggtgtagagcctgaagagaccacatccacgttctgtggtacccctgagtac
ttggcacctgaagtgcttcggaaagagccttatgatcgagcagtggactggtggtgcttg
ggggcagtcctctacgagatgctccatggcctgccgcccttctacagccaagacgtatcc
cagatgtatgagaacattctgcaccagccgctacagatccccgggggccggacggtggcc
gcctgtgacctcctgcaaagccttctccacaaggaccagaggcagcgtctgggctccaaa
gcagactttcttgagattaagaaccatgtattcttcagccccataaactgggatgacctg
taccacaagaggctaactccacccttcaacccaaatgtggcaggacctgctgacttgaag
cattttgacccagagttcacccaggaagctgtgtccaagtccattggctgtacccctgac
actgtggccagcagctctggggcctcaagtgcattcctgggattttcttatgcgccagag
gatgatgacatcttggattgctag

KEGG   Pongo abelii (Sumatran orangutan): 100174621
Entry
100174621         CDS       T01416                                 

Gene name
SGK3
Definition
(RefSeq) serine/threonine-protein kinase Sgk3
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04068  FoxO signaling pathway
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100174621 (SGK3)
   04151 PI3K-Akt signaling pathway
    100174621 (SGK3)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100174621 (SGK3)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   100174621 (SGK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PX Pkinase_C Kinase-like FTA2 Kdo APH
Other DBs
NCBI-GeneID: 100174621
NCBI-ProteinID: NP_001127544
Ensembl: ENSPPYG00000018644
UniProt: Q5R7A7 A0A2J8UR60
LinkDB
Position
8
AA seq 496 aa
MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNT
LKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMD
SPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAK
RKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVL
DFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHV
VLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPP
FYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE
SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADD
AFVGFSYAPPSEDLFL
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgcaaagagatcataccatggactacaaggaaagctgcccaagtgtaagcattcccagc
tctgatgaacacagagagaaaaagaagaggtttactgtttataaagttctggtttcagtg
ggaaggagtgaatggtttgtcttcaggagatatgcagagtttgataaactttacaacact
ttaaaaaaacagtttcctgctatggccctgaagattcctgccaagagaatatttggtgat
aattttgatccagattttattaaacaaagacgagcaggactaaatgaattcattcagaac
ctagttaggtatccagaactttataaccatccagatgtcagagcattccttcaaatggac
agtccaaaacaccagtcagatccatctgaagatgaggatgaaagaagttctcagaagcta
cactctacctcacagaacatcaacctgggaccatctggaaatcctcatgccaaaccaact
gactttgatttcttaaaagttattggaaaaggcagctttggcaaggttcttcttgcaaaa
cggaaactggatggaaaattttatgctgtcaaagtgttacagaaaaaaatagttctcaac
agaaaagagcaaaaacatattatggctgaacgtaatgtgctcttgaaaaatgtgaaacat
ccatttttggttggattgcattattccttccaaacaactgaaaagctttattttgttctg
gattttgttaatggaggggagctttttttccacttacaaagagaacggtcctttcctgag
cacagagctaggttttacgctgctgaaattgctagtgcgttgggttacttacactccatc
aaaatagtatacagagacttgaaaccagaaaatattcttttggattcagtaggacatgtt
gtcttaacagattttgggctttgtaaagaaggaattgctatttctgacaccactaccaca
ttttgtgggacgccagagtatcttgcacctgaagtaattagaaaacagccctatgacaat
actgtagattggtggtgccttggggctgttctgtatgaaatgctgtatggattgcctcct
ttttattgccgagatgttgctgaaatgtatgacaatatccttcacaaacccctaagtttg
aggccaggagtgagtcttacagcctggtccattctggaagaactcctagaaaaagacagg
caaaatcgacttggtgccaaggaagactttcttgaaattcagaatcatcctttttttgaa
tcactcagctgggctgaccttgtacaaaagaagattccaccaccatttaatcctaatgtg
gctggaccagatgatatcagaaactttgacacagcatttacagaagaaacagttccatat
tctgtgtgtgtatcttctgactattctatagtgaatgccagtgtattggaggcagatgat
gcattcgttggtttctcttatgcacctccttcagaagacttatttttgtga

KEGG   Pongo abelii (Sumatran orangutan): 100447685
Entry
100447685         CDS       T01416                                 

Gene name
SGK1
Definition
(RefSeq) serine/threonine-protein kinase Sgk1 isoform X1
  KO
K13302  serum/glucocorticoid-regulated kinase 1 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04068  FoxO signaling pathway
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100447685 (SGK1)
   04151 PI3K-Akt signaling pathway
    100447685 (SGK1)
   04150 mTOR signaling pathway
    100447685 (SGK1)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100447685 (SGK1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100447685 (SGK1)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   100447685 (SGK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Kdo PX APH
Other DBs
NCBI-GeneID: 100447685
NCBI-ProteinID: XP_009240546
UniProt: A0A2J8X996
LinkDB
Position
6
AA seq 431 aa
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKI
SQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
EVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYIN
GGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTD
FGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINW
DDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG
FSYAPPTDSFL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgacggtgaaaaccgaggctgctaagggcaccctcacttactccaggatgaggggcatg
gtggcaattctcatcgctttcatgaagcagaggaggatgggtctgaacgactttattcag
aagattgccaataactcctatgcatgcaaacaccctgaagttcagtccatcttgaaaatt
tcccaacctcaggagcctgagcttatgaatgccaacccttctcctccaccaagtccttct
cagcaaatcaaccttggcccgtcgtccaatcctcatgctaaaccatctgactttcacttc
ttgaaagtgatcgggaagggcagttttggaaaggttcttctagcaagacacaaggcagaa
gaagtgttctatgcagtcaaagttttacagaagaaagcaatcctgaaaaagaaagaggag
aagcatattatgtcggagcggaatgttctgttgaagaatgtgaagcaccctttcctggtg
ggccttcacttctctttccagactgctgacaaattgtactttgtcctagactacattaat
ggtggagagttgttctaccatctccagagggaacgctgcttcctggaaccacgggctcgt
ttctatgctgctgaaatagccagtgccttgggctacctgcattcactgaacatcgtttat
agagacttaaaaccagagaatattttgctagattcacagggacacattgtccttactgac
ttcggactctgcaaggagaacattgaacacaacagcacgacatccaccttctgtggcacg
ccggagtatctcgcacctgaggtgcttcataagcagccttatgacaggaccgtggactgg
tggtgcctgggagccgtcttgtatgagatgctgtatggcttgcctcctttttatagccga
aacacagctgaaatgtatgacaacattctgaacaagcccctccagttgaaaccaaatatt
acaaattccgcaagacacctcctggagggcctcctgcagaaggacaggacaaagcggctc
ggggccaaggatgactttatggagattaagagtcatgtcttcttctccctaattaactgg
gatgatctcattaataagaagattactcccccttttaacccaaatgtgagtgggcccaac
gacctgcggcactttgaccctgagtttaccgaagagcctgtccccaactccattggcaag
tcccctgacagcgtcctcgtcacagccagcgtcaaggaagctgctgaggctttcctaggc
ttttcctatgcacctcccacagactctttcctctga

DBGET integrated database retrieval system