KEGG   Pongo abelii (Sumatran orangutan): 100171842
Entry
100171842         CDS       T01416                                 

Gene name
SOCS4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04630  JAK-STAT signaling pathway
pon04910  Insulin signaling pathway
pon04917  Prolactin signaling pathway
pon04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100171842 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100171842 (SOCS4)
   04917 Prolactin signaling pathway
    100171842 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100171842 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100171842 (SOCS4)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100171842 (SOCS4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 100171842
NCBI-ProteinID: NP_001124969
UniProt: Q5RDX2
LinkDB
Position
14
AA seq 440 aa
MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEV
SLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQAELKDGQLKRRN
MEESINCFSHTNVQPCVITTDNALCREGPITGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKPKWELDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcagaaaataatgaaaatattagtaaaaatgtagatgtaaggcccaaaactagtcgg
agcagaagtgccgacagaaaagacggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgagagttattcagatgctgaaacagtgaatggtatagagaaaactgaagtg
tctttaaggaaccaagaaaggaagcacagctgttcatccattgagttggacttagatcat
tcctgtgggcatcgatttttaggccgatctcttaaacagaaactgcaagatgccgtgggg
cagtgttttccaataaaaaattgtagtagtcggcactcttcagggcttccatctaaaagg
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctcgatcagattta
gcctttaggtggcattttattaaacgacacactgctcctataaattccaaatcagatgaa
tgggtaagcacagacttgtctcaggctgaattgaaggatggtcagctaaaacgaagaaat
atggaagaaagtataaactgtttctcacataccaatgttcagccctgtgtcataaccacc
gacaatgctttgtgtagagaaggtcctatcactggctctgtgatgaacctggtttcaaat
aacagtatagaagatagtgatatggattctgatgatgaaattctaacactttgcacaagt
tccagaaaaagaaacaaacccaaatgggaattggatgatgaaatcctacagttggaaaca
cctcctaaataccacacgcagattgattatgtccactgtcttgtaccagacctccttcag
atcaataacaacccatgttattggggagtgatggataaatatgcagctgaagcactactg
gaaggaaaaccagagggtacctttttacttcgagactcagcacaggaagactatttattc
tctgttagttttagacgttatagtcgttctcttcatgctagaattgaacagtggaatcac
aactttagctttgatgcacacgacccctgtgtcttccattctcctgacattactgggctc
ctagaacattataaggacccaagtgcctgtatgttctttgaaccccttctatccactccc
ttaattcggactttccctttttccctgcaacatatatgcagaacagttatttgtaactgt
acaacttacgatggcatcgatgcccttccaattccttcttctatgaaattatatctgaag
gaatatcattataaatcaaaagttagagtactcaggattgatgcaccagaacagcaatgc
tag

KEGG   Pongo abelii (Sumatran orangutan): 100172146
Entry
100172146         CDS       T01416                                 

Gene name
SOCS6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04630  JAK-STAT signaling pathway
pon04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100172146 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100172146 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100172146 (SOCS6)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100172146 (SOCS6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100172146
NCBI-ProteinID: NP_001125251
Ensembl: ENSPPYG00000009234
UniProt: Q5RCM6 A0A2J8W3U1
LinkDB
Position
18
AA seq 535 aa
MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGED
EKGGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQR
PIRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQS
ETACQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSY
CLDSSSPMEVSAVPPQVGGRSFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSP
RAGQDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgaagaaaattagtcttaaaaccttacggaaatcttttaacttgaataaaagtaaagaa
gaaactgacttcatggtagtacaacaaccatcgctagccagtgactttggaaaagatgat
tccttatttggtagctgctatggtaaagatatggccagctgcgatatcaacggtgaagat
gaaaaaggcggaaaaaacagatcaaaaagcgagagcctgatgggtacgctaaaaaggcgg
ctttctgcaaaacagaagtcaaagggcaaggcgggcacaccctctgggagctctgccgat
gaggacaccttctcctcttcctcagcacccatagtctttaaagacgtgagagctcagagg
ccgataaggtccacctcgctccgcagccaccactacagtcccacgccgtggcctctgcga
cccacaaactccgaggagacctgcatcaagatggaggtgagagtcaaggccttggttcac
tcttccagcccgagtccagccctgaatggcgtccggaaggatttccacgacctccagtct
gagaccgcgtgccaagagcaagccaattcactgaagagctcggcttctcataacggagac
ctgcatcttcacctggatgaacatgtgcctgtcgttattggacttatgcctcaggactac
attcagtataccgtgcctttagatgaggggatgtatcctttggaaggatcacggagctat
tgtctggacagctcttctcccatggaagtctctgccgttcctcctcaagtgggagggcgc
tctttcccggaagatgagagtcaggtagaccaggacctagttgttgccccagagatcttc
gtggatcagtcggtgaatggcttgttgattggcaccacgggagtcatgttgcagagcccg
agagcgggtcaggatgatgtccctccactctcaccattgctacctccaatgcagaataat
caaatccaaaggaacttcagtggactcactggcacagaagcccacgtggctgaaagtatg
cgctgtcatttgaattttgatccgaactctgctcctggggttgcaagagtttatgactca
gtgcaaagtagtggtcccatggttgtgacaagccttacagaggagctgaaaaaacttgca
aagcaaggatggtactggggaccaatcacacgttgggaggcagaagggaagctagcaaac
gtgccagatggttcttttcttgttcgggacagttctgacgaccgttaccttttaagcttg
agctttcgctcccatggtaaaacacttcacactagaattgagcactcaaatggtaggttt
agcttttatgaacagccagatgtggaaggacatacgtccatagttgatctaattgagcat
tcaatcagggactctgaaaatggagctttttgttattcaaggtctcggctgcctggatct
gcaacttaccccgtcagactgaccaacccagtgtcccggttcatgcaggtgcgctcgttg
cagtacctgtgtcgttttgttatacgtcagtataccagaatagacttaattcagaaactg
cctttgccaaacaaaatgaaggattatttacaggagaagcactactga

KEGG   Pongo abelii (Sumatran orangutan): 100437083
Entry
100437083         CDS       T01416                                 

Gene name
SOCS5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04630  JAK-STAT signaling pathway
pon04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100437083 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100437083 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100437083 (SOCS5)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100437083 (SOCS5)
SSDB
Motif
Pfam: SOCS SOCS_box SH2 BRCT_assoc
Other DBs
NCBI-GeneID: 100437083
NCBI-ProteinID: XP_002812103
Ensembl: ENSPPYG00000012434
UniProt: H2P6B2
LinkDB
Position
2A
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCMSVKEKNISIGDSTPQQQSSPLR
ENVALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtgggaaaaatgtggaataacttcaaatacaggtgtcagaatctcttcggt
catgagggaggaagccgtagtgaaaatgtggacatgaactccaacagatgtatgtctgtc
aaagagaaaaacatcagcataggagactcaactcctcagcaacaaagcagtcccttaaga
gaaaatgttgccttacaactgggattaagcccttcaaagaattcttcaaggagaaatcag
aattgtgccacagaaatccctcaaattgttgaaataagcatcgaaaaagataatgattct
tgtgttaccccaggaacaagacttgcacgaagagattcctactctcgacatgctccatgg
ggtgggaagaaaaaacattcctgttctacaaagacccagagttcattggatgctgataaa
aagtttggtagaactcgaagtggacttcaaaggagagagaggcgctacggtgtaagttct
gtacacgacatggacagtgtttccagcagaactgtaggaagtcgctctctaagacagagg
ttgcaggatactgtgggcttgtgttttcctatgagaacttacagcaagcagtcaaagcct
ctcttttccaataaaagaaaaatccatctctctgaattaatgcttgagaaatgccctttt
cctgctggctcagatttagcccaaaaatggcatttgattaaacagcatacagctcctgtg
agcccacattcaacattttttgatacatttgatccatctttggtttctacagaagatgaa
gaagataggcttagagagagaaggcggcttagtattgaagaaggggttgatccccctccc
aatgcacaaatacatacatttgaagctactgcacaggttaatccattatataaactggga
ccaaagttagctcctggaatgactgaaataagtggggacagttctgcaattccacaagct
aattgtgactcggaagaggatacaaccaccctgtgtttgcagtcacggaggcagaagcag
cgtcagatatctggagacagccatacccatgttagcagacagggagcttggaaagtccac
acacagattgattatatacactgcctcgtgcctgatttacttcaaattacagggaatccc
tgttactggggagtgatggaccgttatgaagcagaagcccttcttgaagggaaacctgaa
ggcacgtttttgctcagggactctgcgcaagaggactacctcttctctgtgagcttccgc
cgctacaacagatccctgcatgctcgaattgagcagtggaatcacaactttagtttcgac
gcccatgacccgtgtgtatttcactcctccactgtaacaggacttttagaacattataaa
gatcccagttcgtgcatgttttttgaaccattgcttactatatcactaaataggactttc
ccttttagcctgcagtatatctgtcgcgcggtaatctgcaggtgcactacgtatgatgga
attgatgggctccctctaccctcaatgttacaggattttttaaaagagtatcattataaa
caaaaagttagagttcgctggttagaacgagaaccagtcaaggcaaagtaa

KEGG   Pongo abelii (Sumatran orangutan): 100438503
Entry
100438503         CDS       T01416                                 

Gene name
SOCS7
Definition
(RefSeq) suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04630  JAK-STAT signaling pathway
pon04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100438503 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100438503 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100438503 (SOCS7)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100438503 (SOCS7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 100438503
NCBI-ProteinID: XP_024091172
LinkDB
Position
17
AA seq 544 aa
MVFRNVGRPPEEEDVEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGLEAQL
AALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLVLEGL
ESEAESLETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLSRGEQ
QQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRPSGELAA
SAASLTDMGGSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSP
HPPTPPPPPRRSLSLLDAFPRIAPIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEK
CGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFS
LWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKS
LQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEV
EPST
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggtgttccgcaacgtgggtcggccgccggaggaggaggacgtggaggcggccccggag
ccgggaccctcggaactgctgtgtccccggcaccgctgtgccctggaccccaaggccctg
ccgccgggcttggcgctcgagcggacctggggcccggcggctggactagaggcgcagttg
gcggctctgggtctcgggcagccggccgggccgggggtcaagacagtcggtgggggttgc
tgcccgtgtccgtgtccccctcagccgccccctccgcagccccagccgcctgctgccgcc
ccgcaggccggggaggaccccacggaaacgagcgacgcgctgctggtcctggagggcttg
gaatcggaggccgagagcctggagactaacagctgctcggaagaggagctcagcagcccc
ggtcgcggaggaggagggggcggccggcttctgctgcagcccccaggccctgaattacct
ccggtgcccttcccgctgcaggacttggtccctctggggcgcctgagtagaggggagcag
cagcagcagcaacctcccccgcccccgcctcctcccgggcccctccggccactcgcgggt
ccttctcggaagggctccttcaaaatccgcctcagtcgcctttttcgcaccaagagctgc
aacggtggctccggcggtggggatgggaccggcaagaggccttctggagagctggctgct
tcagctgcgagcctgacagacatgggaggctctgcgggccgggagctggacgcggggagg
aaacccaagttgacaagaactcaaagtgccttttctccggtctccttcagccccctgttc
acaggtgaaactgtgtcgcttgtggatgtggacatttctcagcggggcctgacctctcca
caccctccaactccccctcctcctccgagaagaagcctcagcctcctagatgcatttccc
cggattgctcccatccgagcagctgaatccctgcacagccaacccccacagcacctccag
tgtcccctctaccggcctgactcgagcagctttgcagccagccttcgagagttggagaag
tgtggttggtattgggggccaatgaattgggaagatgcagagatgaagctgaaagggaaa
ccagatggttctttcctggtacgagacagttctgatcctcgttacatcctgagcctcagt
ttccgatcacagggtatcacccaccacactagaatggagcactacagaggaaccttcagc
ctgtggtgtcatcccaagtttgaggaccgctgtcaatctgttgtagagtttattaagaga
gccattatgcactccaagaatggaaagtttctctatttcttaagatccagggttccagga
ctgccaccaactcctgtccagctgctctatccagtgtcccgattcagcaatgtcaaatcc
ctccagcacctttgcagattccggatacgacagctcgtcaggatagatcacatcccagat
ctcccactgcctaaacctctgatctcttatatccgaaagttctactactatgatcctcag
gaagaggtatacctgtctcttaaggaagcgcagctcatttccaaacagaagcaagaggtg
gaaccctccacgtag

KEGG   Pongo abelii (Sumatran orangutan): 100440378
Entry
100440378         CDS       T01416                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04630  JAK-STAT signaling pathway
pon04910  Insulin signaling pathway
pon04917  Prolactin signaling pathway
pon04930  Type II diabetes mellitus
pon04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100440378 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100440378 (SOCS2)
   04917 Prolactin signaling pathway
    100440378 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    100440378 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100440378 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100440378 (SOCS2)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100440378 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 100440378
NCBI-ProteinID: XP_002823630
Ensembl: ENSPPYG00000004834
UniProt: A0A6D2W9T0 A0A2J8XN60
LinkDB
Position
12
AA seq 198 aa
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPEAAHLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagccctccgggaatggcggggaagggacgcggagccagtgg
gggaccgcggggtcggcggaggagccatccccggaggcggcgcatctggcgaaggccctg
cgggagctcggtcagacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagctcgcattcagactac
ctactaacaatatctgttaaaacatcagctggaccaactaatcttcgaatcgaataccaa
gacggaaaattcagattggactctatcatatgtgtcaaatccaagcttaaacaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacaggtcca
gaagcaccccggaacggcactgttcacctttatctgaccaaaccactctacacgtcagca
ccatctctgcagcatctctgtaggctcaccattaacaaatgtaccggtgccatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Pongo abelii (Sumatran orangutan): 100445635
Entry
100445635         CDS       T01416                                 

Gene name
SOCS1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04120  Ubiquitin mediated proteolysis
pon04380  Osteoclast differentiation
pon04630  JAK-STAT signaling pathway
pon04910  Insulin signaling pathway
pon04917  Prolactin signaling pathway
pon04930  Type II diabetes mellitus
pon04935  Growth hormone synthesis, secretion and action
pon05145  Toxoplasmosis
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100445635 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100445635 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100445635 (SOCS1)
   04917 Prolactin signaling pathway
    100445635 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    100445635 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100445635 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100445635 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100445635 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100445635 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100445635 (SOCS1)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100445635 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100445635
NCBI-ProteinID: XP_009248741
Ensembl: ENSPPYG00000007099
UniProt: H2NQ49 A0A663DIK0
LinkDB
Position
16
AA seq 213 aa
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPVPALAPGDTHFRTF
RSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVK
MASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELC
RQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 642 nt   +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcagtctccacagcagcagagccccga
cggcggccagagccttcctcctcttcctcctcctcgcctgcggcccccgcgcgcccgcgg
ccgtgccccgcggtcccggtcccggccctggcccccggcgacacgcacttccgcacattc
cgttcgcacgccgattaccggcgcatcacgcgcgccagcgcgctcctggacgcctgcgga
ttctactgggggcccctgagcgtgcacggggcgcacgagcggctgcgcgccgagcccgtg
ggcaccttcctggtgcgcgacagccgccagcggaactgcttcttcgccctcagcgtgaag
atggcctcgggacccacgagcatccgcgtgcactttcaggccggccgctttcacctggat
ggcagccgcgagagcttcgactgcctcttcgagctgctggagcactacgtggcggcgccg
cgccgcatgctgggggccccgctgcgccagcgccgcgtgcggccgctgcaggagctgtgc
cgccagcgcatcgtggccaccgtgggccgcgagaacctggctcgcatccccctcaacccc
gtcctccgcgactacctgagctccttccccttccagatttga

KEGG   Pongo abelii (Sumatran orangutan): 100446544
Entry
100446544         CDS       T01416                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04120  Ubiquitin mediated proteolysis
pon04380  Osteoclast differentiation
pon04630  JAK-STAT signaling pathway
pon04668  TNF signaling pathway
pon04910  Insulin signaling pathway
pon04917  Prolactin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04935  Growth hormone synthesis, secretion and action
pon05160  Hepatitis C
pon05164  Influenza A
pon05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100446544 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100446544 (SOCS3)
   04668 TNF signaling pathway
    100446544 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100446544 (SOCS3)
   04920 Adipocytokine signaling pathway
    100446544 (SOCS3)
   04917 Prolactin signaling pathway
    100446544 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    100446544 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100446544 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100446544 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    100446544 (SOCS3)
   04931 Insulin resistance
    100446544 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100446544 (SOCS3)
   05164 Influenza A
    100446544 (SOCS3)
   05168 Herpes simplex virus 1 infection
    100446544 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100446544 (SOCS3)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100446544 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100446544
NCBI-ProteinID: XP_002827937
Ensembl: ENSPPYG00000008690
UniProt: A0A6D2X6C9 H2NUW5
LinkDB
Position
17
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgcagtgaccggcggcgaggcgaacctgctgctc
agcgccgagcccgccggcacctttctgatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtctgggaccaagaacctgcgcatccagtgtgaggggggc
agcttctctctgcagagcgatccccggagcacgcagcccgtgccccgcttcgactgcgtg
ctcaagctggtgcaccactacatgccgccccctggagccccctccttcccctcgccacct
actgaaccctcctccgaggtgcccgagcagccgtctgcccagccactccctgggagtccc
cccagaagagcctattacatctactccgggggcgagaagatccccctggtgttgagccgg
cccctctcctccaacgtggccactcttcagcatctctgtcggaagaccgtcaacggccac
ctggactcctatgagaaagtcacccagctgccggggcccattcgggagttcctggaccag
tacgatgccccgctttaa

DBGET integrated database retrieval system