KEGG   Pongo abelii (Sumatran orangutan): 100171900
Entry
100171900         CDS       T01416                                 

Gene name
ZEB2
Definition
(RefSeq) zinc finger E-box-binding homeobox 2
  KO
K23560  zinc finger homeobox protein 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100171900 (ZEB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100171900 (ZEB2)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    100171900 (ZEB2)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-Di19 zf-met zf-C2H2_jaz Homeodomain zf-H2C2_5 zf-C2H2_2 zf-C2H2_6
Other DBs
NCBI-GeneID: 100171900
NCBI-ProteinID: NP_001125020
Ensembl: ENSPPYG00000012831
UniProt: Q5RDN5
LinkDB
Position
2B
AA seq 1214 aa
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQET
SPASVPNHESSPLVSQALLPREEEEDEIREGGVEHPWHNNEILQASVDGPEEMKEDYDTM
GPEATIQTTINNGTVKNANCTSDFEEYFAKRKLEERDGHAVSIEEYLQRSDTAIIYPEAP
EELSRLGTPEANGQEENDLPPGTPDAFAQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEEN
FSCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEH
LRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKTGSSPNSVSSS
PTNSAITQLRNKLENGKPLSMSEQTGLLKIKTEPLDFNDYKVLMATHGFSGTSPFMNGGL
GATSPLGVHPSAQSPMQHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKA
EEISKLKGYHMKDPCSQPEEQGVTSPNIPPVGLPVVSHNGATKSIIDYTLEKVNEAKACL
QSLTTDSRRQISNIKKEKLRTLIDLVTDDKMIENHNISTPFSCQFCKESFPGPIPLHQHE
RYLCKMNEEIKAVLQPHENIVPNKAGVFVDNKALLLSSVLSEKGMTSPINPYKDHMSVLK
AYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQHSNSRSPSLERSSKPLAPNSN
PPTKDSLLPRSPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRS
NTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKAS
SISLDHNSVSSSSENSDEPLNLTFIKKEFSNSNNLDNKSTNPVFGMNPFSAKPLYTALPP
QSAFPPATFMPPVQTSIPGLRPYPGLDQMSFLPHMAYTYPTGAATFADMQQRRKYQRKQG
FQGELLDGAQDYMSGLDDMTDSDSCLSRKKIKKTESGMYACDLCDKTFQKSSSLLRHKYE
HTGKRPHQCQICKKAFKHKHHLIEHSRLRSGEKPYQCDKCGKRFSHSGSYSQHMNHRCSY
CKREAEEREAAEREAREKGHLEPTELLMNRAYLQSITPQGYSDSEERESMPRDGESEKEH
EKEGEDGYGKLGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
TKSDHEEDNMEDGM
NT seq 3645 nt   +upstreamnt  +downstreamnt
atgaagcagccgatcatggcggatggcccccggtgcaagaggcgcaaacaagccaatccc
aggaggaaaaacgtggtgaactatgacaatgtagtggacacaggttctgaaacagatgag
gaagacaagcttcatattgctgaggatgacggtattgccaaccctctggaccaggagacg
agtccagctagtgtgcccaaccatgagtcctccccactcgtgagccaagctctgttgcca
agagaggaagaggaagatgaaataagggagggtggagtggaacacccctggcacaacaac
gagattctacaagcctctgtagatggtccagaagaaatgaaggaagactatgacactatg
gggccagaagccacgatccagaccacaattaacaatggtacagtgaagaatgcaaattgc
acatcagattttgaggaatactttgccaaaagaaagctggaggaacgcgatggtcatgca
gtcagcatcgaggagtaccttcagcgcagtgacacagccattatttacccagaagcccct
gaggagctgtctcgccttggcacgccagaggccaatgggcaagaagaaaatgacctgcca
cctggaactccagatgcttttgcccaactgctgacctgcccctactgcgaccggggctac
aagcgcttgacatcactgaaggagcacatcaagtaccgccacgagaagaatgaagagaac
ttttcctgccctctctgtagctacacgtttgcctaccgcacccagctcgagcggcatatg
gtgacgcacaagccagggacagatcagcaccaaatgctaacccaaggagcaggtaatcgc
aagttcaaatgcacagagtgtggcaaggccttcaaatataaacaccatctgaaagaacac
ctgcgaattcacagtggtgaaaaaccttacgagtgcccaaactgcaagaaacgtttctcc
cattctggttcctacagttcgcacatcagcagcaagaaatgtattggtttaatctctgta
aatggccgaatgagaaacaatatcaagacgggttcttcccctaattctgtttcttcttct
cctactaattcagccattacccagttaagaaacaagttggagaatggaaagccacttagt
atgtctgaacagacaggcttacttaaaattaaaacagaaccactagacttcaatgactat
aaagttcttatggctacacacgggtttagtggcactagtccctttatgaatggtggactt
ggagccaccagccctttgggagttcatccatctgctcagagtccaatgcagcacttaggt
gtagggatggaagcccctttacttgggtttcccaccatgaatagtaatttaagtgaggta
caaaaggttctacagattgtggacaatactgtttccaggcaaaaaatggactgcaaggct
gaagaaatttcaaagttgaaaggttatcacatgaaggatccatgctctcaacctgaggaa
caaggagttacttctcctaatattccgcctgtcggtcttccggtagtgagtcataatggt
gccactaaaagtattattgactatacgttagaaaaagtcaatgaagccaaagcttgcctc
cagagcttgactactgactcaaggagacagatcagtaatataaagaaagagaagctacgt
actttaatagatttggtcaccgatgacaaaatgattgagaaccacaacatatccactcca
ttttcatgccagttctgtaaagaaagttttcctggccccatccctttgcatcagcatgaa
cgttacctttgtaagatgaatgaagagatcaaggcggtcctgcagcctcatgaaaacata
gtccccaacaaagccggagtttttgttgataataaagccctcctcttgtcatctgtactt
tctgagaaaggaatgacaagccccatcaacccatacaaggaccacatgtctgtactcaaa
gcatactatgctatgaacatggagcccaactccgatgaactgctgaaaatttccattgct
gtgggccttcctcaggaatttgtgaaggaatggtttgaacaacgaaaagtctaccagcac
tcaaattccaggtccccatccctggaaagaagctccaagccgttagctcccaacagtaac
cctcccacaaaagactctttattacccaggtctcccgtaaaacctatggactccataaca
tcaccatctatagcagaactccacaacagtgttacgaattgtgatcctcctctcaggcta
acaaaaccttcccattttaccaatattaaaccagttgaaaaattggaccactccaggagt
aatactccttctcccttaaatctttcctccacatcttctaaaaactcccacagtagttca
tacactccaaacagcttctcttctgaggagctccaggctgagcctttagacctgtcatta
ccaaaacaaatgaaagaacccaaaagtattatagccacaaagaacaaaacaaaagctagt
agcatcagtttagatcataacagtgtttcttcctcatctgaaaactcagatgagcctctg
aacttgacttttatcaagaaggaattttcaaattcaaataatctggacaacaaaagcact
aacccagtgttcggcatgaacccatttagtgccaaacctttatacacagctcttccacct
caaagcgcatttccccctgctactttcatgccaccagtccagaccagtattcctgggcta
cgaccatacccaggactggatcagatgagcttcctaccacatatggcctacacctaccca
actggagcagctacttttgctgatatgcagcaaaggagaaagtaccagcggaaacaagga
tttcagggagaattgcttgatggagcacaagactacatgtcaggcctagatgacatgaca
gactccgactcctgtctgtctcgcaagaagatcaagaagacagagagtggcatgtatgca
tgtgacttatgtgacaagacattccagaaaagcagttcccttctgcgacataaatacgaa
cacacaggaaaaagaccacatcagtgtcagatttgtaagaaagcgtttaaacacaagcac
caccttatcgagcactcaaggcttcgctcgggcgagaagccctatcagtgtgataaatgt
ggcaagcgcttctcacactcgggctcgtactcgcagcacatgaatcacaggtgttcctac
tgcaagcgggaggcggaggagcgggaagcggcggagcgcgaggcgcgcgagaaagggcac
ttggaacccaccgagctgctgatgaaccgggcttacttgcagagcattacccctcagggg
tactctgactcggaggagagggagagtatgccgagggatggcgagagcgagaaggagcac
gagaaagaaggcgaggatggctacgggaagctgggcagacaggatggcgacgaggagttc
gaggaggaagaggaagaaagtgaaaataaaagtatggatacggatcccgaaacgatacga
gatgaagaagagactggagatcactccatggacgatagttcggaggatgggaaaatggaa
accaaatcagaccacgaggaagacaatatggaagatggcatgtaa

DBGET integrated database retrieval system