KEGG   Pongo abelii (Sumatran orangutan): 100171951
Entry
100171951         CDS       T01416                                 

Gene name
MYLK3
Definition
(RefSeq) myosin light chain kinase 3
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04510  Focal adhesion
pon04611  Platelet activation
pon04810  Regulation of actin cytoskeleton
pon04921  Oxytocin signaling pathway
pon04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100171951 (MYLK3)
   04020 Calcium signaling pathway
    100171951 (MYLK3)
   04022 cGMP-PKG signaling pathway
    100171951 (MYLK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100171951 (MYLK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100171951 (MYLK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100171951 (MYLK3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100171951 (MYLK3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100171951 (MYLK3)
  09154 Digestive system
   04971 Gastric acid secretion
    100171951 (MYLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100171951 (MYLK3)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100171951 (MYLK3)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100171951 (MYLK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH XhlA
Other DBs
NCBI-GeneID: 100171951
NCBI-ProteinID: NP_001125070
UniProt: Q5RDG7
LinkDB
Position
16
AA seq 819 aa
MSGTSKESLGHGGLPGLGKACLTTMDKKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHL
ERGLHRLEASRAPGPGGTDGVLRVDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAA
VDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGAKPKHVLSASGV
QSDAREPGEESQKADVLEGTVERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHL
PLPTKGEAKAPETPSENLRTGLELAPAPGRVSVVSPSLEVAPGAGQGASSSRPDPEPLEE
GTRLTPGPGPQCPGPPGLPAQARAAHSGGETPPRISIHIQEMGTPGEMLVTGRGSLGPTL
TTDAPAAAQPGKQGPPGTGRCHQAPGTEPGEQTPEGARELSLLQESSSPGGVKAEEEQRA
GAEPGTRPSLARSDDNDHKVGALGLQQGKSPGVGNPEPEQDCAARAPVRAEAVRRTPPGA
EAGSMVLDDSPAPPAPFEHRLVSVKETSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLP
LAAKIIKVKSAKDREDVKNEINIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDR
ITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLA
RRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAET
MNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEESCRMSATQCLKHEWLNNLPAKALRS
KTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRKFPTCP
NT seq 2460 nt   +upstreamnt  +downstreamnt
atgtcaggaacctccaaggagagtctggggcacggggggctgccagggttgggcaaggcc
tgcttaaccaccatggacaaaaagctgaacatgctgaatgagaaggtggaccagctcctg
cacttccaagaagatgtcacagagaagttgcagagcatgtgccgagacatgggccacctg
gagcggggcctgcacaggctggaggcctcccgggcaccgggcccgggcgggactgacggg
gttctccgcgttgacacccaggccgggtggcccgaggtcctggagctggtgagggccatg
cagcaggatgcggcccagcatggtgccaggctggaggccctcttcaggatggtggctgcg
gtggacagggccatcgctttggtgggggccacgttccagaaatcgaaggtggcggatttc
ctcatgcaggggcgtgtcccctggaggagaggcagcccaggtgacagccctgaggagaac
aaagagcgagtagaagaagagggagcaaaaccaaagcatgtgctgagcgccagtggggtg
cagtctgatgccagggagcctggggaagagagccagaaggcggacgtgctggaggggaca
gtggagaggctgccccccatcagagcgtcagggctgggagctgaccccgcccaggcagtg
gtctcaccaggccagggagatggtgttcctggcccagctcaggcattccccggccacctg
cccctgcccacaaagggggaagccaaggctcctgagacacccagcgagaacctcaggact
ggcctggaattggctccagcacccggcagggtcagtgtggtctccccgagcctggaggtt
gcaccaggtgcaggacaaggagcatcgtccagcaggcctgaccctgagcccttagaggaa
ggcacgaggctgactccagggcctggcccccagtgcccagggcctccagggctgccagcc
caggccagggcagcccacagtggtggagaaacacctccaaggatctccatccacatacaa
gagatgggtactcctggggagatgctggtgacaggcaggggcagccttggacccaccctc
accacagatgctccagcagctgcccagccaggcaagcagggcccacctgggaccgggcgc
tgccaccaagcccctgggactgagcccggagaacagacccctgaaggagccagagagctc
tccctgctgcaggagagcagcagccccgggggagtgaaggcagaggaggagcaaagggct
ggggccgagcctggcacgagaccaagtttggccaggagcgatgacaatgaccacaaggtt
ggggccctgggcctgcagcagggcaaaagcccaggggtgggaaaccctgagcctgagcag
gactgtgcagccagggctccggtgagagccgaagcagtaaggaggacgcccccaggcgcc
gaggctggcagcatggttctggatgacagtccggccccgccagctccttttgaacaccgg
ttagtgagcgtcaaggagacctccatctctgcgggttacgaggtgtgccagcacgaagtc
ttgggagggggccggtttggccaggtccacaggtgcacagagaagtccacaggcctcccg
ctggccgccaagatcatcaaagtgaagagcgccaaggaccgggaggacgtgaagaacgag
atcaacatcatgaaccagctcagccacgtgaacctgatccagctctatgacgccttcgag
agcaagcacagctgcaccctcgtcatggagtatgtggacgggggtgagctcttcgaccgg
atcacagacgagaagtaccacctgactgagctggatgtggtcctgttcaccaggcagatc
tgcgagggcgtgcattacctgcaccagcactacatcctgcacctggacctcaagccggag
aacatattgtgtgtcaatcagacaggacatcaaattaagatcattgactttgggctggcc
agaaggtacaagcctcgagagaagctgaaggtgaacttcggcactcctgagttcctggcc
ccagaagttgtcaactatgagtttgtctcattccccacggacatgtggagtgtgggagtc
atcacctacatgctactcagtggcttgtccccatttctaggggaaacagatgcggagacc
atgaatttcattgtaaactgtagctgggattttgatgctgacacctttgaagggctctcg
gaggaggccaaggactttgtttcccggttgctggtcaaagaggagagctgcagaatgagt
gccacacagtgcctgaaacatgagtggctgaataatttgcctgccaaagctttaagatcc
aaaactcgtctcaaatcccaactactgctgcagaaatacatagctcaaagaaaatggaag
aaacatttctatgtggtgactgctgccaacaggttaaggaaatttccaacttgtccctaa

KEGG   Pongo abelii (Sumatran orangutan): 100444714
Entry
100444714         CDS       T01416                                 

Gene name
MYLK4
Definition
(RefSeq) myosin light chain kinase family member 4
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04510  Focal adhesion
pon04611  Platelet activation
pon04810  Regulation of actin cytoskeleton
pon04921  Oxytocin signaling pathway
pon04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100444714 (MYLK4)
   04020 Calcium signaling pathway
    100444714 (MYLK4)
   04022 cGMP-PKG signaling pathway
    100444714 (MYLK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100444714 (MYLK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100444714 (MYLK4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100444714 (MYLK4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100444714 (MYLK4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100444714 (MYLK4)
  09154 Digestive system
   04971 Gastric acid secretion
    100444714 (MYLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100444714 (MYLK4)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100444714 (MYLK4)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100444714 (MYLK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 100444714
NCBI-ProteinID: XP_002816395
Ensembl: ENSPPYG00000016170
LinkDB
Position
6
AA seq 444 aa
MGGKQKKVIPVNSHLQNPIQEKEARKSHNCVLIYKSETEGDENHTPESSLIGLTTKMLKV
KRLEEFSTCYNSNQLEKMAFFQCKEEVEKVKCFLEENSGDQDSRPRHNEVKEVWSNADLT
ERMPVKSKRTSALTVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTEILGGGRFGQVHKCE
ETATGLKLAAKIIKTRGMKDKEEVKNEISVMNQLDHANLIQLYDAFESKNDIVLVMEYVD
GGELFDRIIDENYNLTELDTILFMKQICEGIRHMHQMYILHLDLKPENILCVNRDAKQIK
IIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVIAYMLLSGLSPFL
GDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRISASEALKHPWLSDH
KLHSRLNAQKKKNRGSDAQDFVTK
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgggaggaaaacagaaaaaagtgattccagtcaacagccacctgcagaatcctattcaa
gagaaagaagcacggaagagtcataattgtgtcttgatttataaatcggagacagaggga
gacgaaaaccacactccagaaagtagcttaattggactcactactaagatgttaaaagtg
aagaggctggaagaattcagcacgtgttataacagcaaccagctggagaaaatggccttt
tttcagtgcaaggaagaggtggagaaagtgaagtgttttctggaagaaaattctggggac
caggattcaagacctcgacataatgaggtgaaggaagtgtggtcaaatgccgacctgacg
gaaaggatgcccgtcaaaagcaaaaggacatcagccctcacagttgacatcccggctcct
ccggccccatttgatcaccgtattgtgacagccaagcaaggagcggtcaacagcttctat
actgtgagcaagacagaaatcctaggaggagggcgtttcggccaggttcacaagtgtgag
gagacggccacaggtctgaagctggcagccaaaatcatcaagaccagaggcatgaaggac
aaggaggaggtgaagaacgagatcagtgtcatgaaccagctggaccacgcgaacctcatc
cagctgtacgatgccttcgagtctaagaacgacattgtcctggtcatggagtatgtggat
ggtggagagctgtttgaccgcatcattgatgagaactacaatttgacggagcttgatacc
atcctgttcatgaagcagatatgtgaggggataaggcacatgcatcagatgtacattctc
cacttggacctgaagcctgagaatatcctgtgtgtgaatcgggatgctaagcaaataaaa
attattgattttggattggccagaagatacaaacccagagagaagctgaaggtgaacttt
ggaaccccagaatttctcgcccctgaagttgtgaattacgattttgtttcctttcccact
gacatgtggagtgtgggggtcatcgcctacatgctacttagcggtttgtccccttttctg
ggtgacaatgatgctgagacgctgaacaacatcctggcctgcaggtgggacttagaggat
gaagaatttcaggacatctcggaggaggccaaggagttcatctccaagcttctgattaag
gagaagagttggcgaataagtgcaagcgaagctctcaagcacccctggttgtcagaccac
aagctccactccagactcaatgcccagaagaagaagaatcgtggctctgatgcccaggac
tttgtgaccaaatag

KEGG   Pongo abelii (Sumatran orangutan): 100452913
Entry
100452913         CDS       T01416                                 

Gene name
MYLK
Definition
(RefSeq) myosin light chain kinase, smooth muscle isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04510  Focal adhesion
pon04611  Platelet activation
pon04810  Regulation of actin cytoskeleton
pon04921  Oxytocin signaling pathway
pon04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100452913 (MYLK)
   04020 Calcium signaling pathway
    100452913 (MYLK)
   04022 cGMP-PKG signaling pathway
    100452913 (MYLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100452913 (MYLK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100452913 (MYLK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100452913 (MYLK)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100452913 (MYLK)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100452913 (MYLK)
  09154 Digestive system
   04971 Gastric acid secretion
    100452913 (MYLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100452913 (MYLK)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100452913 (MYLK)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100452913 (MYLK)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 Pkinase 23ISL V-set PK_Tyr_Ser-Thr C2-set_2 fn3 Ig_6 Ig_4 Herpes_gE Kinase-like Kdo Invasin_D3 AvrM_N
Other DBs
NCBI-GeneID: 100452913
NCBI-ProteinID: XP_024101177
Ensembl: ENSPPYG00000013471
LinkDB
Position
3
AA seq 1913 aa
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP
EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE
LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVMVKEGQMGRF
SCKITGRPQPQVTWLKGNVSLQPSARVSMSEKNGMQVLEIHGVSQDDVGVYTCLVVNGSG
KASMSAELSIQGLDSANRSFGRETKATNSDVRKEVTNVISKESKLDSLEAAAESKNCSSP
QRGGSPPWAAKSQPQPPRESKLESYKDSPRMAPQTPVLQKTSSSITLQAARVQPEPRAPG
LGVLSPSGEERKSPAAPRPATFPTRQPGLGSQDVVSKAATRRIPMEGQRDSAFPKFESKP
QSQEVRENQTVKFRCEVSGTPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTR
DSGKYSCTASNAQGQVSCSWTLQVERLAVMEVAPSFSSVLKDCTVIEGQDFVLQCSIQGT
PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAKNALGQVSCSARVTV
REKKSSEKSKYLLPVAPNKPTAPVFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG
NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAMLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV
LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG
GGSDRCGSLRPGWPARGQGWPEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK
GTPKTPVPEKVPLPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS
GPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
RAGTTDNEKRSESQGTAPAFKEKLQDVRVAEGKKLLLQCQVSSDPPATITWTLNGKTLKT
TKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKQIQESEHMKVESSENGSKLTILAARQEHCGCYTLLVENKLGSRQ
AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKMWKE
LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKQTRKVWAGKFFKAYSA
KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDF
DDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEDVSQAFLEAVA
EEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDE
DGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE
NT seq 5742 nt   +upstreamnt  +downstreamnt
atgggggatgtgaaactggttgcctcgtcacacatttccaaaacctccctcagtgtggat
ccctcaagagttgactccatgcccctgacagaggcccctgctttcattttgccccctcgg
aacctctgcatcaaagaaggagccaccgccaagttcgaagggcgggtccggggttaccca
gagccccaggtgacatggcacagaaacgggcaacccatcaccagcgggggccgcttcctg
ctggattgtggcatccgggggactttcagccttgtgattcatgctgtccatgaggaggac
aggggaaagtatacctgtgaagccaccaatggcagtggtgctcgccaggtgacagtggag
ttgacagtagaaggaagttttgcgaagcagcttggtcaacctgttgtttccaaaacctta
ggggatagattttcagctccagcagtggagactcgtcctagcatctggggggagtgccca
ccaaagtttgctaccaagctgggccgagttatggtcaaagaaggacagatgggacgattc
tcctgcaagatcactggccgaccccaaccgcaggtcacctggctcaagggaaatgtttca
ctgcagccgagtgcccgtgtgtctatgtctgagaagaatgggatgcaggttctggaaatc
catggagtcagccaagatgatgtgggagtgtacacgtgcctggtggtgaacgggtcgggg
aaggcctcaatgtcagctgaactttccatccaaggtttggacagcgccaataggtcattt
gggagagaaacaaaagccaccaattcagatgtcaggaaagaggtgaccaatgtaatctca
aaggagtcaaagctggacagtctggaggctgcagccgaaagcaagaactgctccagcccc
cagagaggtggctccccaccctgggctgcaaagagccagcctcagcccccaagggagtcc
aagctggagtcatacaaggactcgcccagaatggccccgcagaccccggtccttcagaag
acttccagctccatcaccctgcaggccgcaagagttcagccagaaccaagagcaccaggc
ctgggggtcctatcaccttctggagaagagaggaagagcccagctgctccccgtccagcc
accttccccaccaggcagcctggcctggggagccaagacgttgtgagcaaggctgctacc
aggagaatccccatggagggccagagggattcagcattccccaaatttgagagcaagccc
caaagccaggaggtcagggaaaatcaaactgtcaagttcagatgtgaagtttccgggact
ccaaagcctgaagtggcctggttcctggaaggcacccccgtgaggagacaggaaggcagc
attgaggtttatgaagatgctggctcccattacctctgcctgctgaaagcccggaccagg
gacagtgggaaatacagctgcactgcttccaacgcccaaggccaggtgtcctgtagctgg
accctccaagtggaaaggcttgccgtgatggaggtggccccctccttctccagtgtcctg
aaggactgcaccgtcattgagggccaggattttgtgctgcagtgctccatacaggggacc
ccagtgccccggatcacttggctgctgaatgggcagcccatccagtacgctcgttccacc
tgtgaggccggcgtggctgagctccacatccaggatgccctgccggaggaccatggcacc
tacacctgcctggctaagaatgccttggggcaggtgtcctgcagcgcccgggtcaccgtc
cgtgaaaagaagagtagcgagaagagcaagtaccttctgcctgtggctcccaacaagccc
actgcacccgtattcctgcagggcctctctgatctcaaagtcatggatggaagccaggtc
actatgactgtccaagtgtcagggaatccaccccctgaagtcatctggctgcacaatggg
aatgagatccaagagtcagaggacttccactttgaacagagaggcactcagcacagcctt
tgtatccaggaagtgttcccagaggacacaggcacgtacacctgcgaggcctggaacagc
gctggagaggtccgcacccaggccatgctcacggtacaagagcctcacgatggcacccag
ccctggttcatcagtaagcctcgctcagtgacagcctccctgggccagagtgtcctcatc
tcctgcgccatagctggtgacccctttcctaccgtgcactggctccgagatggcaaagcc
ctctgcaaagacactggccacttcgaggtgcttcagaatgaggacgtgttcaccctggtt
ctaaagaaggtgcagccctggcatgccggccagtatgagatcctgctcaagaaccgggtt
ggcgaatgcagttgccaggtgtcactgatgttacagaacagctctgccagagcccttcca
cgggggagggagcctgccagctgtgaggacctctgtggtggaggagttggtgctgatggt
ggtggtagtgaccgctgtgggtccctgaggcctggctggccagcaagagggcagggttgg
ccagaggaggaagacggcgaggacgtgcgaggggtgctgaagaggcgcgtggagacgagg
cagcacactgaggaggcgatccgtcagcaggaggtggagcagctggacttccgagacctc
ctggggaagaaggtgagtaccaagaccctatcagaagacgacctgaaggagatcccagcc
gagcagatggatttccgtgccaacctgcagcggcaagtgaagccaaagactgtgtccgag
gaagagaggaaggtgcacagcccccagcaggtcgatttccgctctgtcctggccaagaag
gggactcccaagacccccgtgcctgagaaggtgccactgccaaaacctgccaccccggat
tttcgctcagtgctgggtggcaagaagaaattaccagcagagaatggtagcagcagtgct
gagaccctgaacgccaaggcagtggaaagttccaagcccctgagcaatgcacagccttca
gggcccttgaaacccgtgggcaatgccaagcctgctgagaccctgaagccaatgggcaac
gccaagcctgctgagaccctgaagccaatgggcaacgccaagcctgatgagaacctgaaa
tctgctagcaaagaagaactcaagaaagacgttaagaatgatgtgaactgcaagagaggc
cgtgcagggaccacagataatgaaaagagatcagagagccaggggacagccccagccttc
aaggagaagctgcaagatgttcgtgtggcagagggcaagaagctgctgctccagtgccag
gtgtcttctgaccccccagccaccatcacctggacgctgaatggaaagaccctcaagacc
accaagttcatcatcctctcccaggaaggctcactctgctccgtctccatcgagaaggca
ctgcctgaggacagaggcttatacaagtgtgtagccaagaatgacgctggccaggctgag
tgctcctgccaagtcactgtggacgatgctccagccagtgagaacaccaaggccccagag
atgaaatcccggaggcccaagagctctcttcctcccgtgctaggaactgagagtgatgcg
actgtgaaaaagaaacctgcccccaagacacctccaaaggcagcaatgccccctcagatc
atccagttccccgaggaccagaaggtacgcgcaggagagtcagtggagctgtttggtaaa
gtgacaggcactcagcccatcacctgtacctggatgaagttccgaaagcagatccaggaa
agcgagcacatgaaggtggagagcagcgagaatggcagcaagctcaccatcctggccgcg
cgccaggagcactgcggctgctacacactgctggtggagaacaagctgggcagcaggcag
gcccaggtcaacctcactgtcgtggataagccagaccccccagctggcacaccttgtgcc
tctgacattcggagctcctcactgaccctgtcctggtacggctcctcatatgatgggggc
agcgctgtacagtcctacagcatcgagatctgggactcggccaacaagatgtggaaggaa
ctagccacatgccgcagcacctctttcaatgtccaggacctgctgcctgaccacgaatat
aagttccgtgtacgtgcaatcaatgtgtatggaaccagtgagccaagccaggagtctgaa
ctcacaacggtaggagagaaacctgaagagccgaaggatgaagtggaggtgtcagacgat
gatgagaaggagcccgaggttgattaccggacagtgacaatcaatactgaacaaaaagta
tctgacttctacgacattgaagagagattaggatctgggaaatttggacaggtctttcga
cttgtagaaaaacaaactcgaaaagtctgggcagggaagttcttcaaagcatattcagca
aaagagaaagagaatatccggcaggagatcagcatcatgaactgcctccaccaccccaag
ctggtccagtgtgtggatgccttcgaagaaaaggccaacatcgtcatggtcctggagatc
gtgtcaggaggtgagctgtttgagcgcatcattgacgaggactttgagctgacggagcgc
gagtgcatcaagtacatgcggcagatctcagagggggtggagtacatccacaagcagggc
atcgtgcacctggacctcaagccggagaacatcatgtgtgtcaacaagacgggcaccagg
atcaagctcatcgactttggtctggccaggaggctggagaacgcggggtctctgaaggtc
ctctttggcaccccggagtttgtggctcctgaagtgatcaactatgagcccatcggctac
gccacagacatgtggagcatcggggtcatctgctacatcctagtcagtggcctttccccc
ttcatgggagacaacgataacgaaaccttggccaacgttacgtcagccacctgggacttc
gacgacgaggcattcgatgagatctccgatgatgccaaggatttcatcagcaatctgctg
aagaaagatatgaaaaaccgcctggactgcacgcagtgccttcagcatccatggctaatg
aaagataccaagaacatggaggccaagaaactctccaaggacaggatgaagaagtacatg
gcaagaaggaaatggcagaaaacgggcaatgctgtgagagccattggaagactgtcctct
atggcaatgatctcagggctcagtggcaggaaatcctcaacagggtcaccaaccagcccg
ctcaatgcagaaaaactagaatctgaagatgtgtcccaagctttccttgaggctgttgct
gaggaaaagcctcatgtaaaaccctatttctctaagaccattcgtgatttagaagtcgtg
gagggaagtgctgctagatttgactgcaagattgaaggatacccggaccctgaggttgtc
tggttcaaagatgaccagtcaatcagggagtcccgccacttccagatagactacgatgag
gacgggaactgctctttaattattagtgatgtttgcggggatgacgatgccaagtacacc
tgcaaggctgtcaacagtcttggagaagccacctgcacagcagagctcattgtggaaacg
atggaggaaggcgaaggggaaggggaagaggaagaagagtga

KEGG   Pongo abelii (Sumatran orangutan): 100453783
Entry
100453783         CDS       T01416                                 

Gene name
MYLK2
Definition
(RefSeq) myosin light chain kinase 2, skeletal/cardiac muscle
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04510  Focal adhesion
pon04611  Platelet activation
pon04810  Regulation of actin cytoskeleton
pon04921  Oxytocin signaling pathway
pon04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100453783 (MYLK2)
   04020 Calcium signaling pathway
    100453783 (MYLK2)
   04022 cGMP-PKG signaling pathway
    100453783 (MYLK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100453783 (MYLK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100453783 (MYLK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100453783 (MYLK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100453783 (MYLK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100453783 (MYLK2)
  09154 Digestive system
   04971 Gastric acid secretion
    100453783 (MYLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100453783 (MYLK2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100453783 (MYLK2)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100453783 (MYLK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH
Other DBs
NCBI-GeneID: 100453783
NCBI-ProteinID: XP_024094944
Ensembl: ENSPPYG00000010893
LinkDB
Position
20
AA seq 596 aa
MATENGAVELGIQNPSTDKAPKGPAGERPLGAGKDPGPPDPKKAPGPPTLKKDAKAPASE
KGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGS
QDPEKPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVP
MTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKVQGDTSRGIEFQAVPSEKSEV
GQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVC
TCMEKATGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFME
YIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGH
LVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLS
PFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWL
NNLAEKAKRCNRRLKSQILLKKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggcgacagaaaatggagcagttgagctgggaattcagaacccatcaacagacaaggca
cctaaaggtcccgcaggtgaaagacccctgggtgcagggaaagaccctggccccccagac
ccaaagaaagctcctggtccacccaccctgaagaaagatgccaaagcccctgcctcagag
aaaggggatggtaccctggcccaaccctcaactagcagccaaggccccaaaggagagggt
gacaggggtggagggcccgcggagggcagtgctggtcccccggcagccctgccccagcag
actgcgacgcccgagaccagcgtcaagaagcccaaggctgagcagggagcctcaggcagc
caggatcctgaaaagcccagggtgggcaagaaggcagcagagggccaagcagcagccagg
aggggctcacctgcctttctgcatagccccagctgtcccgccatcatctccagttctgag
aagctgctggccaagaagcccccaagtgaggcatcagagctcacctttgaaggggtgccc
atgacccacagccccacggatcccaggccagccaaggcagaagaaggaaagaacatcctg
gcagagagccagaaggaagtgggagagaaaaccccaggccaggctggccaggctaaggtg
caaggggacacctcgagggggatcgagttccaggctgttccctcagagaaatccgaggtg
gggcaggccctctgtctcacagccagggaggaggactgcttccagattttggatgattgc
ccgccacccccggcccccttccctcaccgcatggtggagctgaggactgggaatgtcagc
agtgaattcagtatgaactccaaggaggcgctcggaggtggcaagtttggggcagtctgt
acctgcatggagaaagccacaggcctcaagctggcagccaaggtcatcaagaaacagaca
cccaaagacaaggaaatggtgttgctggagattgaggtcatgaaccagctgaaccaccgc
aatctgatccagctctacgcagccatcgagactccacatgagatcgtcctgttcatggag
tacatcgagggcggagagctcttcgagaggattgtggatgaggactaccatctgaccgag
gtggacaccatggtgtttgtcaggcagatctgtgacgggatcctcttcatgcacaagatg
agggttttgcacctggacctcaagccagagaacatcctgtgtgtcaataccaccgggcat
ttggtgaagatcattgactttggcctggcacggaggtataaccccaacgagaagctgaag
gtgaactttgggaccccagagttcctgtcacctgaggtggtgaattatgaccaaatctcc
gataagacagacatgtggagcatgggggtgatcacctacatgctgctgagtggcctctcc
cccttcctgggagatgatgacacagagaccctaaacaacgttctgtctggcaactggtac
tttgacgaagagacctttgaggccgtatcagatgaggccaaagactttgtctccaacctc
attgtcaaggaccagagggcccggatgaatgctgcccagtgtctcgcccacccctggctc
aacaacctggcagagaaagccaagcgctgtaaccgacgccttaagtcccagatcttgctt
aagaaatacctcatgaagaggcgctggaagaaaaacttcattgctgtcagcgctgccaac
cgcttcaagaagatcagcagctcaggggcattgatggctctgggggtctga

DBGET integrated database retrieval system