KEGG   Pongo abelii (Sumatran orangutan): 100172060
Entry
100172060         CDS       T01416                                 

Gene name
PRKAA2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04068  FoxO signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04371  Apelin signaling pathway
pon04530  Tight junction
pon04710  Circadian rhythm
pon04714  Thermogenesis
pon04910  Insulin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon05410  Hypertrophic cardiomyopathy
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100172060 (PRKAA2)
   04068 FoxO signaling pathway
    100172060 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    100172060 (PRKAA2)
   04152 AMPK signaling pathway
    100172060 (PRKAA2)
   04150 mTOR signaling pathway
    100172060 (PRKAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100172060 (PRKAA2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100172060 (PRKAA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100172060 (PRKAA2)
   04922 Glucagon signaling pathway
    100172060 (PRKAA2)
   04920 Adipocytokine signaling pathway
    100172060 (PRKAA2)
   04921 Oxytocin signaling pathway
    100172060 (PRKAA2)
  09149 Aging
   04211 Longevity regulating pathway
    100172060 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    100172060 (PRKAA2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100172060 (PRKAA2)
   04714 Thermogenesis
    100172060 (PRKAA2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100172060 (PRKAA2)
   05410 Hypertrophic cardiomyopathy
    100172060 (PRKAA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100172060 (PRKAA2)
   04931 Insulin resistance
    100172060 (PRKAA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100172060 (PRKAA2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100172060 (PRKAA2)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100172060 (PRKAA2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100172060 (PRKAA2)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100172060 (PRKAA2)
Membrane trafficking [BR:pon04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100172060 (PRKAA2)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100172060 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    100172060 (PRKAA2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 100172060
NCBI-ProteinID: NP_001125173
Ensembl: ENSPPYG00000001303
UniProt: Q5RD00
LinkDB
Position
1
AA seq 552 aa
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNIMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFF
EMCASLITTLAR
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaagatcggacactacgtgctgggcgac
acgctgggcgtcggcaccttcggcaaagtgaagattggagaacatcaattaacaggccat
aaagtggcagttaaaatcttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatctaaaactgtttcgtcatcctcatattatcaaactatac
caggtgatcagcactccaacagatttttttatggtaatggaatatgtgtctggaggtgaa
ttatttgactacatctgtaagcatggacgggttgaagagatggaagccaggcggctcttt
cagcagattctgtctgctgtggattactgtcataggcatatggttgttcatcgagacctg
aaaccagagaatgtcctgttggacgcacacatgaatgccaagatagccgattttggacta
tctaatataatgtcagatggtgaatttctgagaactagttgcggatctccaaattatgca
gcacctgaagtcatctcaggcagattgtatgcaggtcctgaagttgatatctggagctgt
ggtgttatcttgtatgctcttctttgtggcaccctcccatttgatgatgagcatgtacct
acgttatttaagaagatccgaggcggtgtcttttatatcccagaatatctcaatcgttct
gttgccactctcctgatgcatatgctgcaggttgacccactgaaacgagcaactatcaaa
gacataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccttcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gaatgtacagaatcagaagtaatgaacagtttatatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcctccatctggttcttttatggacgatagtgccatgcatattccc
ccaggcctgaaacctcatccagaaagaatgccacctcttatagcagacagccccaaagca
agatgtccattggatgcactgaatacgactaagcccaaatctttagctgtgaaaaaagcc
aagtggcatcttggaatccgaagtcagagcaaaccgtatgacattatggctgaagtttac
cgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatcttcgtgta
agaagaaaaaatccagtgactggcaattacgtgaaaatgagcttacaactttacctggtt
gataacaggagctatcttttggactttaaaagcattgatgatgaagtagtggagcagagg
tctggttcctcaacacctcagcgttcctgttctgctgctggcttacacagaccaagatca
agttttgattccacaactgcagagagccattcactttctggctctctcactggctctttg
accggaagcacattgtcttcagtttcacctcgcctgggcagtcacaccatggattttttt
gaaatgtgtgccagtctgattactactttagcccgttga

KEGG   Pongo abelii (Sumatran orangutan): 100174304
Entry
100174304         CDS       T01416                                 

Gene name
PRKAA1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04068  FoxO signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04371  Apelin signaling pathway
pon04530  Tight junction
pon04710  Circadian rhythm
pon04714  Thermogenesis
pon04910  Insulin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon05410  Hypertrophic cardiomyopathy
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100174304 (PRKAA1)
   04068 FoxO signaling pathway
    100174304 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    100174304 (PRKAA1)
   04152 AMPK signaling pathway
    100174304 (PRKAA1)
   04150 mTOR signaling pathway
    100174304 (PRKAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100174304 (PRKAA1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100174304 (PRKAA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100174304 (PRKAA1)
   04922 Glucagon signaling pathway
    100174304 (PRKAA1)
   04920 Adipocytokine signaling pathway
    100174304 (PRKAA1)
   04921 Oxytocin signaling pathway
    100174304 (PRKAA1)
  09149 Aging
   04211 Longevity regulating pathway
    100174304 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    100174304 (PRKAA1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100174304 (PRKAA1)
   04714 Thermogenesis
    100174304 (PRKAA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100174304 (PRKAA1)
   05410 Hypertrophic cardiomyopathy
    100174304 (PRKAA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100174304 (PRKAA1)
   04931 Insulin resistance
    100174304 (PRKAA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100174304 (PRKAA1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100174304 (PRKAA1)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100174304 (PRKAA1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100174304 (PRKAA1)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100174304 (PRKAA1)
Membrane trafficking [BR:pon04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100174304 (PRKAA1)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100174304 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    100174304 (PRKAA1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 100174304
NCBI-ProteinID: NP_001127249
Ensembl: ENSPPYG00000015421
UniProt: Q5RDH5
LinkDB
Position
5
AA seq 550 aa
MATAEKQKHDGRVRIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVV
GKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRR
LFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPN
YAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLN
PSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCE
KFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTR
PHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIK
QLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTA
TPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEM
CANLIKILAQ
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggcgacagccgagaagcagaaacacgacgggcgggtgaggatcggccactacatcctg
ggtgacacgctgggggtcggcaccttcggcaaagtgaaggttggcaaacatgaattgact
gggcataaagtagctgtgaagatactcaatcgacagaagattcggagccttgatgtggta
ggaaaaatccgcagagaaattcagaacctcaagcttttcaggcatcctcatataattaaa
ctgtaccaagtcatcagtacaccatctgatattttcatggtgatggaatatgtctcagga
ggagagctatttgattatatctgtaagaatggaaggctggatgagaaagaaagtcggcgt
ctgttccaacagatcctttctggtgtggattattgtcacaggcatatggtggtccataga
gatttgaaacctgaaaatgtcctgcttgatgcacacatgaatgcaaagatagctgatttt
ggtctttcaaacatgatgtcagatggtgaatttttaagaacaagttgtggctcacccaac
tatgctgcaccagaagtaatttcaggaagattgtatgcaggcccagaggtagatatatgg
agcagtggggttattctctatgctttattatgtggaacccttccatttgatgatgaccat
gtgccaactctttttaagaagatatgtgatgggatcttctatacccctcaatatttaaat
ccttctgtgattagccttttgaaacatatgctgcaggtggatcccatgaagagggccaca
atcaaagatatcagggaacatgaatggtttaaacaggaccttccaaagtatctctttcct
gaggatccatcatatagttcaaccatgattgacgatgaagccttaaaagaagtatgtgaa
aagtttgagtgctcagaagaggaagttctcagctgtctttataacagaaatcaccaggat
cctttggcagttgcctaccatctcataatagataataggagaataatgaatgaagccaaa
gatttctatttggcgacaagcccacctgattcttttcttgatgatcatcacctgactcgg
ccccatcctgaaagagtaccattcttggttgctgaaacaccaagggcacgccataccctt
gatgaattaaatccacagaaatccaaacaccaaggtgtaaggaaagcaaaatggcattta
ggaattagaagtcaaagtcgaccaaatgatattatggcagaagtatgtagagcaattaaa
caattggattatgaatggaaggttgtaaacccatattatttgcgtgtacgaaggaagaat
cctgtgacaagcacttactccaaaatgagtctacagttataccaagtggatagtagaact
tatctactggatttccgtagtattgatgatgaaattacagaagccaaatcagggactgct
actccacagagatcgggatcagttagcaactatcgatcttgccaaaggagtgattcagat
gctgaggctcaaggaaaatcctcagaagtttctcttacctcatctgtgacctcacttgac
tcttctcctgttgacctaactccaagacctggaagtcacacaatagaattttttgagatg
tgtgcaaatctaattaaaattcttgcacaataa

DBGET integrated database retrieval system