KEGG   Pongo abelii (Sumatran orangutan): 100172074
Entry
100172074         CDS       T01416                                 

Gene name
MITF
Definition
(RefSeq) microphthalmia-associated transcription factor isoform X3
  KO
K09455  microphthalmia-associated transcription factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04137  Mitophagy - animal
pon04380  Osteoclast differentiation
pon04916  Melanogenesis
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05218  Melanoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100172074 (MITF)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100172074 (MITF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100172074 (MITF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172074 (MITF)
   05202 Transcriptional misregulation in cancer
    100172074 (MITF)
  09162 Cancer: specific types
   05218 Melanoma
    100172074 (MITF)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    100172074 (MITF)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH DUF726
Other DBs
NCBI-GeneID: 100172074
NCBI-ProteinID: XP_002813580
Ensembl: ENSPPYG00000013725
UniProt: A0A6D2XBZ6 H2PAA2
LinkDB
Position
3
AA seq 520 aa
MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSSSSAEHPGASKPPISSSSMTSRILLR
QQLMREQMQEQERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQ
THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNS
PMAMLTLNSNCEKEGFYKFEEQNRVESECPGMNTHSRASCMQMDDVIDDIISLESSYNEE
ILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTESEARAL
AKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQR
EQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEP
VLENCSQDLLQHHADVTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILM
DDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHAC
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgcagtccgaatcggggatcgtgccggatttcgaagtcggggaggagtttcatgaagag
cccaaaacctattacgaactcaaaagtcaaccgctgaagagcagcagttccgcggagcat
cctggggcctccaagcctccgataagctcctccagtatgacatcacgcatcttgctacgc
cagcaactcatgcgtgagcagatgcaggagcaggagcgcagggagcagcagcagaagctg
caggcggcccagttcatgcaacagagagtgcccgtgagtcagacaccagccataaacgtc
agtgtgcccaccacccttccctctgccacgcaggtgccgatggaagtccttaaggtgcag
acccacctcgaaaaccccaccaagtaccacatacagcaagcccaacggcagcaggtaaag
cagtacctttctaccactttagcaaataaacatgccaaccaagtcctgagcttgccatgt
ccaaaccagcctggcgatcatgtcatgccaccggtgccggggagcagcgcacccaacagc
cccatggctatgcttacgcttaactccaactgtgaaaaagagggattttataagtttgaa
gagcaaaacagggtggagagcgagtgcccaggcatgaacacacattcacgagcgtcctgt
atgcagatggatgatgtaatcgatgacatcattagcctagaatcaagttataatgaggaa
atcttgggcttgatggatcctgctttgcaaatggcaaatacgttgcctgtctcgggaaac
ttgattgatctttatggaaaccaaggtctgcccccaccaggcctcaccatcagcaactcc
tgtccagccaaccttcccaacataaaaagggagctcacagagtctgaagcaagagcactg
gccaaagagaggcagaaaaaggacaatcacaacctgattgaacgaagaagaagatttaac
ataaatgaccgcattaaagaactaggtactttgattcccaagtcaaatgatccagacatg
cgctggaacaagggaaccatcttaaaagcatccgtggactatatccgaaagttgcaacga
gaacagcaacgcgcaaaagaacttgaaaaccgacagaagaaactggagcacgccaaccgg
catttgttgctcagaatacaggaacttgaaatgcaggctcgagctcatggactttccctt
attccatccacgggtctctgctctccagatttggtgaatcggatcatcaagcaagaaccc
gttcttgagaactgcagccaagacctccttcagcatcatgcagacgtaacttgtacaaca
actctcgatctcacggatggcaccatcaccttcaacaacaaccttggaactgggactgag
gccaaccaagcctatagtgtccccacaaaaatgggatccaaactggaagacatcctgatg
gacgacaccctttctcccgtcggtgtcactgatccactcctttcctcagtgtcccctgga
gcttccaaaacaagcagccggaggagcagtatgagcatggaagagacggagcatgcttgt
tag

DBGET integrated database retrieval system