KEGG   Pongo abelii (Sumatran orangutan): 100172097Help
Entry
100172097         CDS       T01416                                 

Gene name
CBR1
Definition
(RefSeq) carbonyl reductase [NADPH] 1
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00590  Arachidonic acid metabolism
pon00790  Folate biosynthesis
pon00980  Metabolism of xenobiotics by cytochrome P450
pon01100  Metabolic pathways
pon05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100172097 (CBR1)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100172097 (CBR1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100172097 (CBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100172097 (CBR1)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     100172097 (CBR1)
    1.1.1.189  prostaglandin-E2 9-reductase
     100172097 (CBR1)
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     100172097 (CBR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_4 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 100172097
NCBI-ProteinID: NP_001125206
Ensembl: ENSPPYG00000011399
UniProt: Q5RCU5
LinkDB All DBs
Position
21
AA seq 277 aa AA seqDB search
MSSGMHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVARGQAAVQQLQAEGLSPRFH
QLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRD
VCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTK
KGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDRILLNACCPGWVRTDMAGPKA
TKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccggcatgcatgtagcgctggtgactggaggcaacaagggtatcggcttggcc
atcgtgcgcgacctgtgccggctgttctcgggggacgtggtgctcacggcgcgggacgtg
gcgcggggccaggcagccgtgcagcagctgcaggcggagggcctgagcccgcgcttccac
cagctggacatcgacgatctgcagagcatccgcgccctgcgcgacttcctgcgcaaggag
tacgggggcctggacgtgctggtcaacaacgcgggcatcgccttcaaggttgctgatccc
acaccctttcatattcaagccgaagtgacgatgaaaacaaacttctttggtacccgagat
gtgtgcacagaattactccctctaataaaaccccaagggagagtggtgaacgtatctagc
atcatgagcgtcagagcccttaaaagctgcagcccagagctgcagcagaagttccgcagt
gagaccatcactgaggaggagctggtggggctcatgaacaagtttgtggaggatacaaag
aagggagtgcaccagaaggagggctggcccagcagcgcatacggggtgacgaagattggt
gtcaccgttctgtccaggatccacgccaggaaactgagtgagcagaggaaaggggacagg
atcctcctgaatgcctgctgcccagggtgggtgagaaccgacatggcgggacccaaggcc
accaagagcccagaagaaggagcagagacccctgtgtacttggcccttttgcccccagat
gctgagggtccccatggacaatttgtttcggagaagagagttgaacagtggtga

DBGET integrated database retrieval system