KEGG   Pongo abelii (Sumatran orangutan): 100172117
Entry
100172117         CDS       T01416                                 

Gene name
ARRB2
Definition
(RefSeq) beta-arrestin-2
  KO
K04439  beta-arrestin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04062  Chemokine signaling pathway
pon04144  Endocytosis
pon04340  Hedgehog signaling pathway
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172117 (ARRB2)
   04340 Hedgehog signaling pathway
    100172117 (ARRB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100172117 (ARRB2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100172117 (ARRB2)
  09152 Endocrine system
   04929 GnRH secretion
    100172117 (ARRB2)
   04926 Relaxin signaling pathway
    100172117 (ARRB2)
   04928 Parathyroid hormone synthesis, secretion and action
    100172117 (ARRB2)
  09156 Nervous system
   04728 Dopaminergic synapse
    100172117 (ARRB2)
  09157 Sensory system
   04740 Olfactory transduction
    100172117 (ARRB2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100172117 (ARRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100172117 (ARRB2)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    100172117 (ARRB2)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C SCA7
Other DBs
NCBI-GeneID: 100172117
NCBI-ProteinID: NP_001125224
Ensembl: ENSPPYG00000007838
UniProt: Q5RCR4 A0A2J8SPM5
LinkDB
Position
17
AA seq 409 aa
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQS
AAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgggggagaaacccgggaccagggtcttcaagaagtcgagccctaactgcaagctcacc
gtgtacttgggcaagcgggacttcgtagatcacctggacaaagtggaccctgtagatggc
gtggtgcttgtggaccctgactacctgaaggaccgcaaagtgtttgtgaccctcacctgc
gccttccgctatggccgtgaagacctggatgtgctgggcttgtccttccgcaaagacctg
ttcatcgccacctaccaggccttccccccggtgcccaacccaccccggccccccacccgc
ctgcaggaccggctgctgaggaagctgggccagcatgcccaccccttcttcttcaccata
ccccagaatcttccatgctccgtcacactgcagccaggcccagaggatacaggaaaggcc
tgcggcgtagactttgagattcgagccttctgtgctaaatcactagaagagaaaagccac
aaaaggaactctgtgcggctggtgatccgaaaggtgcagttcgccccggagaaacccggc
ccccagccttcagccgaaaccacacgccacttcctcatgtctgaccggtccctgcacctc
gaggcttccctggacaaggagctgtactaccatggggagcccctcaatgtaaatgtccac
gtcaccaacaactccaccaagaccgtcaagaagatcaaagtctctgtgagacagtacgcc
gacatctgcctcttcagcaccgcccagtacaagtgtcctgtggctcaactcgaacaagat
gaccaggtatctcccagctccacattctgtaaggtgtacaccataaccccactgctcagc
gacaaccgggagaagcggggtctcgccctggatgggaaactcaagcacgaggacaccaac
ctggcttccagcaccatcgtgaaggagggtgccaacaaggaggtgctgggaatcctggtg
tcctacagggtcaaggtgaagctggtggtgtctcgaggcggggatgtctctgtggagctg
ccttttgttcttatgcaccccaagccccacgaccacatccccctccccagaccccagtca
gccgctccggagacagatgtccctgtggacaccaacctcattgaatttgataccaactat
gccacagatgatgacattgtgtttgaggactttgcccggcttcggctgaaggggatgaag
gatgacgactatgatgatcaactctgctag

KEGG   Pongo abelii (Sumatran orangutan): 100440492
Entry
100440492         CDS       T01416                                 

Gene name
ARRB1
Definition
(RefSeq) beta-arrestin-1 isoform X1
  KO
K04439  beta-arrestin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04062  Chemokine signaling pathway
pon04144  Endocytosis
pon04340  Hedgehog signaling pathway
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04929  GnRH secretion
pon05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100440492 (ARRB1)
   04340 Hedgehog signaling pathway
    100440492 (ARRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100440492 (ARRB1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100440492 (ARRB1)
  09152 Endocrine system
   04929 GnRH secretion
    100440492 (ARRB1)
   04926 Relaxin signaling pathway
    100440492 (ARRB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100440492 (ARRB1)
  09156 Nervous system
   04728 Dopaminergic synapse
    100440492 (ARRB1)
  09157 Sensory system
   04740 Olfactory transduction
    100440492 (ARRB1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100440492 (ARRB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100440492 (ARRB1)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    100440492 (ARRB1)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C AP3B1_C LDB19
Other DBs
NCBI-GeneID: 100440492
NCBI-ProteinID: XP_024111085
Ensembl: ENSPPYG00000003687
LinkDB
Position
11
AA seq 418 aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgggcgacaaagggacccgagtgttcaagaaggccagtccgaatggaaagctcaccgtc
tacctgggaaagcgggactttgtggaccacatcgacctcgtggaccctgtggatggtgtg
gtcctggtggatcctgagtatctcaaagagcggagagtctacgtgacgctgacctgcgcc
ttccgctatggccgggaggacctggatgtcctgggcctgacctttcgcaaggacctgttt
gtggccaacgtacagtccttcccaccggcccccgaggacaagaagcccctgacgcggctg
caggagcgcctcatcaagaagctgggcgagcacgcttaccctttcacctttgagatccct
ccaaaccttccatgctctgtgacgctgcagccggggcccgaagacacggggaaggcttgc
ggtgtggactatgaagtcaaagccttctgcgcggagaatttggaggagaagatccataag
cggaattctgtgcgtctggtcatccggaaggttcagtatgccccagagaggcctggcccc
cagcccacagccgagaccaccaggcagttcctcatgtcggacaagcccttgcacctagag
gcctccctggataaggagatctattaccatggagaacccatcagtgtcaacgtccacgtc
accaacaacaccaacaagacggtgaagaagatcaagatctcagtgcgccagtatgcagac
atctgccttttcaacacagctcagtacaagtgccctgttgccatggaagaggctgatgac
actgtggcacccagctcgacgttctgcaaggtctacacactgacccccttcctagccaat
aaccgagagaagcggggcctcgccttggacgggaagctcaagcacgaagacacgaacttg
gcctctagcaccctgttgagggaaggtgccaaccgtgagatcctggggatcattgtttcc
tacaaagtgaaagtgaagctggtggtgtctcggggcggcctgttgggagatcttgcatcc
agtgatgtggccgtggaactgcccttcaccctaatgcaccccaagcccaaagaggaaccc
ccgcatcgggaagttccagagaacgagacgccagtagataccaatctcatagaacttgac
acaaatgatgacgacattgtatttgaggactttgctcgccagagactgaaaggcatgaag
gatgacaaggaggaagaggaggatggtaccggctctccacagctcaacaacagatag

DBGET integrated database retrieval system