KEGG   Pongo abelii (Sumatran orangutan): 100172142
Entry
100172142         CDS       T01416                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6 precursor
  KO
K02376  frizzled 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100172142 (FZD6)
   04390 Hippo signaling pathway
    100172142 (FZD6)
   04150 mTOR signaling pathway
    100172142 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100172142 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100172142 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172142 (FZD6)
   05205 Proteoglycans in cancer
    100172142 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100172142 (FZD6)
   05226 Gastric cancer
    100172142 (FZD6)
   05217 Basal cell carcinoma
    100172142 (FZD6)
   05224 Breast cancer
    100172142 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100172142 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    100172142 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100172142 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100172142 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100172142 (FZD6)
G protein-coupled receptors [BR:pon04030]
 Frizzled / Smoothened family
  100172142 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec RseC_MucC Integrin_alpha
Other DBs
NCBI-GeneID: 100172142
NCBI-ProteinID: NP_001125247
Ensembl: ENSPPYG00000018806
UniProt: Q5RCN4
LinkDB
Position
8
AA seq 706 aa
MEMFTFLLTCIFLPLVRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEH
FLPLANLECSPNIETFLCKAFVPTCTEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEE
LECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREV
KADGASTPRLREQDCGEPASPAASISRLSGEQVDRKGQAGSVSESARSEGRISPKSDITD
TGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggaaatgtttacatttttgttgacgtgtatttttctacccctcgtaagagggcacagt
ctcttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatctgatgggtcattatgaccagagtattgccgcggtggaaatggagcat
tttcttcctctcgcaaatctggaatgttcaccaaacattgaaactttcctctgcaaagca
tttgtaccaacctgcacagagcaaattcatgtggttccaccttgtcgtaaactttgtgag
aaagtatattctgattgcaaaaaattaattgacacttttgggatccgatggcctgaggag
cttgaatgtgacagattacaatactgtgatgagactgttcctgtaacttttgatccacac
acagaatttcttggtcctcagaagaaaacagaacaagtccaaagagacattggattttgg
tgtccaaggcatcttaagacttctgggggacaaggatataagtttctgggaattgaccaa
tgtgcgcctccatgccccaacatgtattttaaaagtgatgagctagagtttgcaaaaagt
tttattggaacagtttcaatattttgtctttgtgcaactctgttcacattccttactttt
ttaattgatgttagaagattcagatacccagagagaccaattatatattactctgtctgt
tacagcattgtatctcttatgtacttcattggatttttgctaggcgatagcacagcctgc
aataaggcagatgagaagctagaacttggtgacactgttgtcctaggctctcaaaataag
gcttgcaccgttttgttcatgcttttgtattttttcacaatggctggcactgtgtggtgg
gtgattcttaccattacttggttcttagctgcaggaagaaaatggagttgtgaagccatc
gaacaaaaagcagtgtggtttcatgctgttgcatggggaacaccaggtttcttgaccgtt
atgcttcttgctatgaacaaagttgaaggagacaacattagtggagtttgctttgttggc
ctttatgacctggatgcttctcgctactttgtactcttgccactgtgcctttgtgtgttt
gttgggctctctcttcttttagctggcattatttccttaaatcatgttcgacaagtcata
caacatgatggccggaaccaagaaaaactaaagaaatttatgattcgaattggagtcttc
agtggcttgtatcttgtgccattagtgacacttcttggatgttacgtctatgagcaagtg
aacaggattacctgggagataacttgggtttctgatcattgtcgtcagtaccatatccca
tgtccttatcaggcaaaggcaaaagctcgaccagaattggctttatttatgataaaatac
ctgatgacattaattgttggcatctctgctgtcttctgggttggaagcaaaaagacatgc
acagaatgggctgggttttttaaacgaaatcgcaagagagatccaatcagtgaaagtcga
agagtactacaggaatcatgtgagtttttcttaaagcacaattctaaagttaaacacaaa
aagaagcactataaaccaagttcacacaagctgaaggtcatttccaaatccatgggaacc
agcacaggagctacagcaaatcatggcacttctgcagtagcaattactagccatgattac
ctaggacaagaaactttgacagaaatccaaacctcaccagaaacatcaatgagagaggtg
aaagcggacggagctagcacccccaggttaagagaacaggactgtggtgaacctgcctcg
ccagcagcatccatctccagactctctggggaacaggtcgacaggaagggccaggcaggc
agtgtatctgaaagtgcacggagtgaaggaaggattagtccaaagagtgatattactgac
accggcctggcacagagcaacaatttgcaggtccccagttcttcagaaccaagcagcctc
aaaggttccacatctctgcttgttcacccggtttcaggagtgagaaaagagcagggaggt
ggttgtcattcagatacttga

KEGG   Pongo abelii (Sumatran orangutan): 100437467
Entry
100437467         CDS       T01416                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100437467 (FZD7)
   04390 Hippo signaling pathway
    100437467 (FZD7)
   04150 mTOR signaling pathway
    100437467 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100437467 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100437467 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100437467 (FZD7)
   05205 Proteoglycans in cancer
    100437467 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100437467 (FZD7)
   05226 Gastric cancer
    100437467 (FZD7)
   05217 Basal cell carcinoma
    100437467 (FZD7)
   05224 Breast cancer
    100437467 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100437467 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    100437467 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100437467 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100437467 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100437467 (FZD7)
G protein-coupled receptors [BR:pon04030]
 Frizzled / Smoothened family
  100437467 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 100437467
NCBI-ProteinID: XP_009236269
Ensembl: ENSPPYG00000013080
UniProt: H2P8B3 A0A663D5J3
LinkDB
Position
2B
AA seq 574 aa
MRDPGAAAPRSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgcgggaccccggagcggccgctccgcgttcgtccctgggcctctgtgccctggtgctg
gcgctgctgggcgcgctgtccgcgggcgccggggcgcagccgtaccacggagagaagggc
atctccgtgccggaccacggcttctgccagcccatctccatcccgctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgttgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccagttctacccgttggtgaaggtgcagtgttctcccgaactccgcttc
ttcctatgctccatgtatgcgcctgtgtgcaccgtgctcgatcaggctatcccgccgtgt
cgttctctgtgcgagcgcgcccgccagggctgcgaggcgctcatgaacaagttcggcttc
cagtggcccgagcggctgcgctgcgagaacttcccggtgcacggtgcgggcgagatctgc
gtgggccagaacacgtcggacggctccgggggcccaggcggcggccccacagcctaccct
accgcgccctacctgccggacctgcccttcaccgcgctgcccccgggagcctcagatggc
agggggcgtcccgccttccccttctcatgcccccgtcagctcaaggtgcccccctacctg
ggctaccgcttcctgggtgagcgcgattgcggcgccccgtgcgaaccgggccgtgccaac
ggcctgatgtactttaaggaggaggagaggcgcttcgcccgcctttgggtgggcgtgtgg
tcggtgctgtgctgcgcctcgacgctctttaccgttctcacctacctggtggacatgcgg
cgcttcagctacccagagcgtcccatcatcttcctgtcgggctgctacttcatggtggcc
gtggcgcacgtggccggcttccttctggaggaccgcgccgtgtgcgtggagcgcttctcg
gacgatggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccattctcttc
atggtgctctacttcttcggcatggccagctccatctggtgggtcattctgtcgctcact
tggttcctggcggccggcatgaagtggggccacgaggccatcgaggccaactcgcagtac
ttccacctggccgcgtgggccgtgcccgccgtcaagaccatcactatcctggccatgggc
caggtagacggggacctgctcagcggggtgtgctacgttggcctatccagtgtggacgcg
ctgcggggcttcgtgctggcgcctctgttcgtctacctcttcatcggcacgtccttcttg
ctggccggcttcgtgtccctcttccgtatccgcaccatcatgaaacacgacggcaccaag
accgagaagctggagaagctcatggtgcgcatcggcgtcttcagcgtgctctacacagtg
cccgccaccatcgtcctggcctgctacttctacgagcaggccttccgcgagcactgggaa
cgcacctggctcctgcagacgtgcaagagctatgccgtgccctgcccgcccggccacttc
ccgcccatgagccccgacttcaccgtcttcatgatcaagtacctgatgaccatgatcgtg
ggcatcaccactggcttctggatctggtcgggcaagaccttgcagtcgtggcgccgcttc
taccacagacttagccacagcagcaagggggagactgcagtatga

KEGG   Pongo abelii (Sumatran orangutan): 100438736
Entry
100438736         CDS       T01416                                 

Gene name
FZD9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100438736 (FZD9)
   04390 Hippo signaling pathway
    100438736 (FZD9)
   04150 mTOR signaling pathway
    100438736 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100438736 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100438736 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100438736 (FZD9)
   05205 Proteoglycans in cancer
    100438736 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100438736 (FZD9)
   05226 Gastric cancer
    100438736 (FZD9)
   05217 Basal cell carcinoma
    100438736 (FZD9)
   05224 Breast cancer
    100438736 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100438736 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    100438736 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100438736 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100438736 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100438736 (FZD9)
   04090 CD molecules [BR:pon04090]
    100438736 (FZD9)
G protein-coupled receptors [BR:pon04030]
 Frizzled / Smoothened family
  100438736 (FZD9)
CD molecules [BR:pon04090]
 Proteins
  100438736 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 100438736
NCBI-ProteinID: XP_002817910
Ensembl: ENSPPYG00000017504
UniProt: H2PLY5 A0A6D2X859
LinkDB
Position
7
AA seq 591 aa
MAVAPLRGALLLWQLLAAGGAALEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNL
LGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARL
RCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPA
RPPGDLGQGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSA
LCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGA
LYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHM
AAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTG
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRA
TEQPCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSL
CHRKIAAGRARAKACRAPGSYGRGMHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggcagtggcgcctctgcggggggcgctgctgctgtggcagctgctggcggcgggcggc
gcggcactggagatcggccgcttcgacccggagcgcgggcgcggggctgcgccgtgccag
gcggtggagatccccatgtgccgcggcatcggctacaacctgacccgcatgcccaacctg
ctgggccacacgtcacagggcgaggcggccgccgagctggcggagttcgcgccgctggtg
cagtacggctgccacagccacctgcgcttcttcctgtgctcgctctacgcgcccatgtgc
accgaccaggtctcgacgcccattcccgcctgccggcccatgtgcgagcaggcgcgcctg
cgctgcgcgcccatcatggagcagttcaacttcggctggccggactcgctcgactgcgcc
cggctgcccacgcgcaacgacccgcacgcgctgtgcatggaggcgcccgagaacgccacg
gccggccccgcggagccccacaagggcctgggcatgctgcccgtggcgccgcggcccgcg
cgccctcccggggacctgggccagggcgcgggcggcagtggcacctgcgagaaccccgag
aagttccagtacgtggagaagagccgctcgtgcgcaccgcgctgcgggcccggcgtcgag
gtgttctggtcccggcgcgacaaggacttcgcgctggtctggatggccgtgtggtcggcg
ctgtgcttcttctccaccgccttcaccgtgctcaccttcttgctggagccccaccgcttc
cagtaccccgagcgccccatcatcttcctctccatgtgctacaacgtctactcgctggcc
ttcctgatccgtgcggtggccggagcgcagagcgtggcctgtgaccaggaggcgggcgcg
ctctacgtgatccaggagggcctggagaacacgggctgcacgctggtcttcctactgctc
tactacttcggcatggccagctcgctctggtgggtggtcctgacgctcacgtggttcctg
gcggccgggaagaaatggggccacgaggccatcgaggcccacggcagctatttccacatg
gctgcctggggcctgcccgcgctcaagaccatcgtcatcttgaccctgcgcaaggtggcg
ggtgatgagctgacagggctctgctatgtggccagcacggacgcagcggcgctcacgggc
ttcgtgctggtgcccctctccggctacctggtgctgggcagtagtttcctcctgaccggc
ttcgtggccctcttccacatccgcaagatcatgaagacgggcggtaccaacacagagaag
ctggagaagctcatggtcaagatcggagtcttctccatcctctacacggtgcccgccacc
tgcgtcatcgtttgctatgtctacgaacgcctcaacatggacttctggcgccttcgggcc
acagagcagccatgcgcagcggccgcggggcccggaggccggagggactgctcgctgcca
gggggctcggtgcccaccgtggcggtcttcatgctcaaaattttcatgtcactggtggtg
gggatcaccagcggtgtctgggtgtggagctccaagactttccagacctggcagagcctg
tgccaccgcaagatagcagctggccgggcccgggccaaggcctgccgcgcccctgggagc
tacggacgtggcatgcactgccactataaggctcccaccgtggtcttgcacatgactaag
acggacccctctctggagaaccccacacacctctag

KEGG   Pongo abelii (Sumatran orangutan): 100442825
Entry
100442825         CDS       T01416                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100442825 (FZD10)
   04390 Hippo signaling pathway
    100442825 (FZD10)
   04150 mTOR signaling pathway
    100442825 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100442825 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100442825 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100442825 (FZD10)
   05205 Proteoglycans in cancer
    100442825 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100442825 (FZD10)
   05226 Gastric cancer
    100442825 (FZD10)
   05217 Basal cell carcinoma
    100442825 (FZD10)
   05224 Breast cancer
    100442825 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100442825 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    100442825 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100442825 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100442825 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100442825 (FZD10)
   04090 CD molecules [BR:pon04090]
    100442825 (FZD10)
G protein-coupled receptors [BR:pon04030]
 Frizzled / Smoothened family
  100442825 (FZD10)
CD molecules [BR:pon04090]
 Proteins
  100442825 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100442825
NCBI-ProteinID: XP_002824035
Ensembl: ENSPPYG00000005120
UniProt: A0A6D2W1P0 H2NJ49
LinkDB
Position
12
AA seq 581 aa
MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEH
PLKDGGPGRSGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHK
CKMNNQTKTLDCLMATSIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLK
KKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQPPTCV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgcagcgcccgggcccccgcctgtggctggtcctgcaggtgatgggctcgtgcgccgcc
atcagctccatggacatggagcgcccgggcgacggcaaatgccagcccatcgagatcccg
atgtgcaaggacatcggctacaacatgactcgcatgcccaacctgatgggccacgagaac
cagcgcgaggcagccatccaactgcacgagttcgcgccgctggtggagtacggctgccac
ggccacctccgcttcttcctgtgctcgctgtacgcgccgatgtgcaccgagcaggtctcc
acccccatccccgcctgccgggtcatgtgcgagcaggcccggctcaagtgctccccgatt
atggagcagttcaacttcaagtggcccgactccctggactgccggaaactccccaacaag
aacgaccccaactacctgtgcatggaggcgcccaacaacggctcggacgagcccacccgg
ggctcgggccttttcccgccgctgttccggccgcagcggccccacagcgcgcaggagcac
ccgctgaaggacgggggccccggacgcagcggctgcgacaacccgggcaagttccaccac
gtggagaagagcgcttcgtgcgcgccgctctgcacgcccggcgtggacgtgtactggagc
cgcgaggacaagcgcttcgccgtggtctggctggccatctgggccgtgctgtgcttcttc
tccagcgccttcaccgtgctcaccttcctcatcgacccggcccgcttccgctaccccgag
cgccccatcatcttcctctccatgtgctactgcgtctactccgtgggctacctcatccgc
ctcttcgccggcgccgagagcatcgcctgcgaccgggacagcggccagctctatgtcatc
caggagggactggagagcaccggctgcacgctggtcttcctggtcctctactacttcggc
atggccagctcgctgtggtgggtggtcctcacgctcacctggttcctggccgccggcaag
aagtggggccacgaggccatcgaagccaacagcagctacttccacctggcagcctgggcc
atcccggcggtgaagaccatcctgatcctggtcatgcgcagggtggcgggggatgagctc
accggggtctgctacgtgggcagcatggacgtcaacgcgctcaccggcttcgtgctcatt
cccctggcctgctacctggtcatcggcacgtccttcatcctctcgggcttcgtggccctg
ttccacatccgaagggtgatgaagacgggcggcgagaacacggacaagctggagaagctc
atggtgcgtatcgggctcttctctgtgctgtacaccgtgccggccacctgtgtgatcgcc
tgctacttttacgaacgcctcaacatggattactggaagatcctggcggcgcagcacaag
tgcaaaatgaacaaccagactaaaacgctggactgcctgatggccacctccatccccgcc
gtggagatcttcatggtgaagatctttatgctgctggtggtgggcatcaccagcgggatg
tggatttggacctccaagactctgcagtcctggcagcaggtgtgcagccgtaggttaaag
aagaagagccggagaaaaccggccagcgtgatcaccagcggtgggatttacaaaaaagcc
cagcatccccagaaaactcaccacgggaaatatgagatccctgcccagccgcccacctgc
gtgtga

KEGG   Pongo abelii (Sumatran orangutan): 100444369
Entry
100444369         CDS       T01416                                 

Gene name
FZD1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100444369 (FZD1)
   04390 Hippo signaling pathway
    100444369 (FZD1)
   04150 mTOR signaling pathway
    100444369 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100444369 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100444369 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100444369 (FZD1)
   05205 Proteoglycans in cancer
    100444369 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100444369 (FZD1)
   05226 Gastric cancer
    100444369 (FZD1)
   05217 Basal cell carcinoma
    100444369 (FZD1)
   05224 Breast cancer
    100444369 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100444369 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    100444369 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100444369 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100444369 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100444369 (FZD1)
G protein-coupled receptors [BR:pon04030]
 Frizzled / Smoothened family
  100444369 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 100444369
NCBI-ProteinID: XP_002818308
Ensembl: ENSPPYG00000017827
UniProt: A0A6D2XT10 H2PMY3
LinkDB
Position
7
AA seq 649 aa
MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLARQLLLLLW
LLEAPLLLGVRAQAAGQGPGQGPGPGQQPPPPPPPQQQQSGQQYNGERGISIPDHGYCQP
ISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCT
VLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTP
TPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGA
PCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFL
SGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSI
WWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCF
VGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIG
VFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSP
DFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggctgaggaggaggcgcctaagaagtcccgggccgccggcggtggcgcgagctgggaa
ctttgtgccggggcgctctcggcccggctggcggaggagggcagcggggacgccggtggc
cgccgccgccccccagttgacccccggcgattggcgcgccagctgctgctgctgctttgg
ctgctggaggctccgttgttgctgggggtccgggcccaggcggcgggccaggggccaggc
caggggcccgggccggggcagcaaccgccgccgccgccgccgcctcagcagcaacagagc
gggcagcagtacaacggcgagcggggcatctccatcccggaccacggctattgccagccc
atctccatcccgctgtgcacggacatcgcgtacaaccagaccatcatgcccaacctgctg
ggccacacgaaccaggaggacgcgggcctggaggtgcaccagttctaccctctagtgaaa
gtgcagtgttccgctgagctcaagttcttcctgtgctccatgtacgcgcccgtgtgcacc
gtgctagagcaggcgctgccgccctgccgctccctgtgcgagcgcgcgcgccagggctgc
gaggcgctcatgaacaagttcggcttccagtggccagacacgctcaagtgcgagaagttc
ccagtgcacggcgccggcgagctgtgcgtgggccagaacacgtccgacaagggcaccccg
acgccctcgctgcttccagagttctggaccagcaaccctcagcacggcggcggagggcac
cgtggcggcttcccggggggcgccggcgcgtcggagcgaggcaagttctcctgcccgcgc
gccctcaaggtgccctcctacctcaactaccacttcctgggggagaaggactgcggcgca
ccctgtgagccgaccaaggtgtatgggctcatgtacttcgggcccgaggagctgcgcttc
tcgcgcacctggattggcatttggtcagtgctgtgctgcgcctccacgctcttcacggtg
cttacgtacctggtggacatgcggcgcttcagctacccggagcggcccatcatcttcttg
tccggctgttacacggccgtggccgtggcctacatcgccggcttcctcctggaagaccga
gtggtgtgtaacgacaagttcgccgaggacggggcacgcactgtggcgcagggcaccaag
aaggagggctgcaccattctcttcatgatgctctacttcttcagcatggccagctccatc
tggtgggtgatcctgtcgctcacctggttcctggcggctggcatgaagtggggccacgag
gccatcgaagccaactcacagtattttcacctggccgcctgggctgtgccggccatcaag
accatcaccatcctggcgctgggccaggtggacggcgatgtgctgagcggagtgtgcttc
gtggggcttaacaacgtggatgcgctgcgtggcttcgtgctggcgcccctcttcgtgtac
ctgtttatcggcacgtcctttctgctggccggctttgtgtcgctcttccgcatccgcacc
atcatgaagcatgatggcaccaagaccgagaagctggagaagctcatggtgcgcattggc
gtcttcagcgtgctgtacactgtgccagccaccatcgtcatcgcctgctacttctacgag
caggccttccgggaccagtgggaacgcagctgggtggcccagagctgcaagagctacgct
atcccctgccctcacctccaggcgggcggaggcgccccgccgcacccgcccatgagcccg
gacttcacggtcttcatgatcaagtaccttatgacgctgatcgtgggcatcacgtcgggc
ttctggatctggtccggcaagaccctcaactcctggaggaagttctacacgaggctcacc
aacagcaaacaaggggagactaccgtctga

KEGG   Pongo abelii (Sumatran orangutan): 100447615
Entry
100447615         CDS       T01416                                 

Gene name
FZD4
Definition
(RefSeq) frizzled-4
  KO
K02354  frizzled 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100447615 (FZD4)
   04390 Hippo signaling pathway
    100447615 (FZD4)
   04150 mTOR signaling pathway
    100447615 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100447615 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100447615 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447615 (FZD4)
   05205 Proteoglycans in cancer
    100447615 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100447615 (FZD4)
   05226 Gastric cancer
    100447615 (FZD4)
   05217 Basal cell carcinoma
    100447615 (FZD4)
   05224 Breast cancer
    100447615 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100447615 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    100447615 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100447615 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100447615 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100447615 (FZD4)
   04090 CD molecules [BR:pon04090]
    100447615 (FZD4)
G protein-coupled receptors [BR:pon04030]
 Frizzled / Smoothened family
  100447615 (FZD4)
CD molecules [BR:pon04090]
 Proteins
  100447615 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 100447615
NCBI-ProteinID: XP_002822378
LinkDB
Position
11
AA seq 540 aa
MLAMAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLG
YNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPC
GGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQP
GEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFT
VLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGL
KNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAV
KTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIR
SNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVE
MLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgctggccatggcctggcggggcgcagggccgagcgtcccgggggcgcccgggggcgtc
ggtctcagtctggggttgctcctgcagttgctgctgctcctggggccggcgcggggcttc
ggggacgaggaggagcggcgctgcgaccccatccgcatctccatgtgccagaacctcggc
tacaacgtgaccaagatgcccaacctggttgggcacgagctgcagacggacgccgagctg
cagctgacaactttcacaccgctcatccagtacggttgctccagccagctgcagttcttc
ctttgttctgtttatgtgccaatgtgcacagagaagatcaacatccccattggcccatgc
ggcggcatgtgtctttcagtcaagaggcgctgtgaacccgtcctgaaggaatttggattt
gcctggccagagagtctgaactgcagcaaattcccaccacagaacgaccacaaccacatg
tgcatggaagggccaggtgatgaagaggtgcccttacctcacaaaacccccatccagcct
ggggaagaatgtcactctgtgggaaccaattctgatcagtacatctgggtgaaaaggagc
ctaaactgtgtgctcaagtgtggctatgatgctggcttatacagccgatcagccaaggag
ttcactgatatctggatggctgtgtgggccagcctgtgcttcatctccactgccttcaca
gtactgaccttcctgatcgattcttctaggttttcctaccctgagcgccccatcatattt
ctcagtatgtgctataatatttatagcattgcttatattgtcaggctgactgtaggccgg
gaaaggatatcctgtgattttgaagaggcagcagaacctgttctcatccaagaaggactt
aagaacacaggatgtgcaataattttcttgctgatgtacttttttggaatggccagctcc
atttggtgggttattctgacactcacttggtttttggcagcaggactcaaatggggtcat
gaagccattgaaatgcacagctcatatttccacattgcagcctgggccatccccgcagtg
aaaaccattgtcatcttgattatgagactggtggatgcagatgaactcactggcctgtgc
tatgttggaaaccaaaatcttgatgccctcaccgggttcgtggtggctcccctctttact
tatttggtgattggaactttgttcattgctgcaggtttggtggccttgttcaaaattcgg
tcaaatcttcaaaaggatgggacaaagacagacaagttagaaagactgatggtcaagatt
ggggtgttctcagtactgtacacagttcctgcaacgtgtgtaattgcctgttatttttat
gaaatctccaactgggcactctttcggtattctgcggatgattccaacatggctgttgaa
atgttgaaaatttttatgtctttgttggtgggcatcacttcaggcatgtggatttggtct
gccaaaactcttcacacgtggcagaagtgttccaacagattggtgaattctggaaaggta
aagagagagaagagaggaaatggttgggtgaagcctgggaaaggcaatgagactgtggta
taa

KEGG   Pongo abelii (Sumatran orangutan): 100452043
Entry
100452043         CDS       T01416                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100452043 (FZD2)
   04390 Hippo signaling pathway
    100452043 (FZD2)
   04150 mTOR signaling pathway
    100452043 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100452043 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100452043 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452043 (FZD2)
   05205 Proteoglycans in cancer
    100452043 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100452043 (FZD2)
   05226 Gastric cancer
    100452043 (FZD2)
   05217 Basal cell carcinoma
    100452043 (FZD2)
   05224 Breast cancer
    100452043 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100452043 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    100452043 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100452043 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100452043 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100452043 (FZD2)
G protein-coupled receptors [BR:pon04030]
 Frizzled / Smoothened family
  100452043 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100452043
NCBI-ProteinID: XP_002827477
Ensembl: ENSPPYG00000008328
UniProt: H2NTT7 A0A663DHV6
LinkDB
Position
17
AA seq 565 aa
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTP
GGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgctgctgccgctgctgctgctgcccgccgcc
gggccggcccagttccacggggagaagggcatctccattccggaccacggcttctgccag
cccatctccatcccgctgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccacacgaaccaggaggacgcaggcctggaggtgcaccagttctatccgctggtg
aaggtgcagtgctcgcccgaactgcgcttcttcctgtgctccatgtatgcacccgtgtgc
accgtgctggaacaggccatcccgccgtgccgctctatctgtgagcgcgcgcgccagggc
tgcgaagcgctcatgaacaagttcggttttcagtggcccgagcgcctgcgctgcgagcac
ttcccgcgccacggcgccgagcagatctgcgtgggccagaaccactccgaggacggagcg
cccgcgctactcaccaccgcgccgccgccgggactgcagccgggtgccgggggcaccccg
ggtggcccgggcggcggcggcgctcccccgcgctacgccactctggagcaccccttccac
tgcccgcgcgtcctcaaggtgccatcctatctcagctacaagtttctgggcgagcgtgat
tgtgctgcgccctgcgaacccgcgcggcccgatggttccatgttcttctcacaggaggag
acgcgtttcgcgcgcctctggatcctcacctggtcggtgctgtgctgcgcctccaccttc
ttcactgtcaccacgtacttggtagacatgcagcgcttccgctacccagagcggcctatc
atttttctatcgggctgctacaccatggtgtcggtggcctacatcgcgggcttcgtgctc
caggagcgcgtggtgtgcaacgagcgcttctccgaagacggttaccgcacggtggtgcag
ggcaccaagaaggagggctgcaccatcctcttcatgatgctctacttcttcagcatggcc
agctccatctggtgggtcatcctgtcgctcacctggttcctggcagccggcatgaagtgg
ggccacgaggccatcgaggccaactctcagtacttccacctggccgcctgggccgtgccg
gccgtcaagaccatcaccatcctggccatgggccagatcgacggcgacctgctgagcggc
gtgtgcttcgtgggcctcaacagcctggacccgctgcggggcttcgtgctagcgccgctc
ttcgtgtacctgttcatcggcacgtccttcctcctggccggcttcgtgtcgctcttccgc
atccgcaccatcatgaagcacgacggcaccaagaccgaaaagctggagcggctcatggtg
cgcatcggcgtcttctccgtgctctacacagtgcccgccaccatcgtcatcgcttgctac
ttctacgagcaggccttccgcgagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgcccggcgcactacacgccgcgcatgtcgcccgacttcacggtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tcgggcaagacgctgcactcgtggaggaagttctacactcgcctcaccaacagccggcac
ggcgagaccaccgtgtga

KEGG   Pongo abelii (Sumatran orangutan): 100457942
Entry
100457942         CDS       T01416                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3
  KO
K02329  frizzled 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100457942 (FZD3)
   04390 Hippo signaling pathway
    100457942 (FZD3)
   04150 mTOR signaling pathway
    100457942 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100457942 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100457942 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    100457942 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100457942 (FZD3)
   05206 MicroRNAs in cancer
    100457942 (FZD3)
   05205 Proteoglycans in cancer
    100457942 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100457942 (FZD3)
   05226 Gastric cancer
    100457942 (FZD3)
   05217 Basal cell carcinoma
    100457942 (FZD3)
   05224 Breast cancer
    100457942 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100457942 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    100457942 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100457942 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100457942 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100457942 (FZD3)
G protein-coupled receptors [BR:pon04030]
 Frizzled / Smoothened family
  100457942 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100457942
NCBI-ProteinID: XP_002818999
Ensembl: ENSPPYG00000018477
UniProt: A0A6D2W8K8 A0A2J8X5B0
LinkDB
Position
8
AA seq 666 aa
MAMTWIVFSFWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMILYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQANRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgacttggattgtcttctctttttggcccttgactgtgttcatggggcatata
ggtggtcacagtttgttttcttgtgaacccattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcattatgaccaacagacagcagctttg
gcaatggagccattccatcctatggtgaatctggattgttctcgggatttccggcctttt
ctttgtgcactctatgctcctatttgtatggaatatggacgtgtcacacttccctgtcgt
aggctgtgtcagcgggcttacagtgagtgttcgaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccgtatcctcgactt
gtggatctgaatttagctggagaaccaactgaaggagccccagtggcagtgcagagagac
tatggtttttggtgtccccgagagttaaaaattgatcctgatctgggttattcttttctg
cacgtgcgtgattgttcacctccttgtccaaatatgtacttcagaagagaagaactgtca
tttgctcgctatttcataggattgatttcaatcatttgcctctcagccacattgtttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaaggcctattatattt
tatgcagtctgctacatgatggtatccttaattttcttcattggatttttgcttgaggat
cgagtagcctgcaatgcatccatccctgcacaatataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatgatactctatttttttactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctgtttcacgccagtgcatggggcatccccgga
actctaaccatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgctcccctctgc
ctgtatgtggtagttggggtttctctcctcttagctggcattatatccctaaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaattagtgaagtttatgatccgg
atcggtgttttcagcattctttatctcgtaccactcttggtggtaattggatgctacttt
tatgagcaagctaaccggggcatctgggaaacaacgtggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtccagacttgattctcttt
ctgatgaaatacctgatggctctcatagttggcattccctctgtattttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactccaggaacctgattttgctcagtctctcctgagggatcca
aatactcctatcataagaaagtcaaggggaacttccactcaaggaacatccacccatgct
tcttcaactcagctggctatggtggatgatcaaagaagcaaagcgggaagcatccacagc
aaagtgagcagctaccacggcagcctccacagatcacgtgatggcaggtacacaccctgc
agttacagaggaatggaggagagactacctcatggcagcatgtcacgactaacagaccac
tccaggcatagtagttctcatcggctcaatgaacagtcacgacatagcagcatcagagat
ctcagtaataatcccatgactcacatcacacatggcaccagcatgaatcgggttattgaa
gaagatggaaccagtgcttaa

KEGG   Pongo abelii (Sumatran orangutan): 100458618
Entry
100458618         CDS       T01416                                 

Gene name
FZD5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100458618 (FZD5)
   04390 Hippo signaling pathway
    100458618 (FZD5)
   04150 mTOR signaling pathway
    100458618 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100458618 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100458618 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458618 (FZD5)
   05205 Proteoglycans in cancer
    100458618 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100458618 (FZD5)
   05226 Gastric cancer
    100458618 (FZD5)
   05217 Basal cell carcinoma
    100458618 (FZD5)
   05224 Breast cancer
    100458618 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100458618 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    100458618 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100458618 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100458618 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100458618 (FZD5)
G protein-coupled receptors [BR:pon04030]
 Frizzled / Smoothened family
  100458618 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100458618
NCBI-ProteinID: XP_002812832
Ensembl: ENSPPYG00000013119
UniProt: A0A6D2YBR5 H2P8F5
LinkDB
Position
2B
AA seq 585 aa
MARPDPSAPPSLLLLLLAQLVGRATAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRTEATTAPPRPFPAKPTLPGPPGAPASGG
ECPAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSHV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggctcggcctgacccatccgcgccgccctcgctgttgctgctgctcctggcgcagctg
gtgggccgggcgaccgccgcgtccaaggccccggtgtgccaggaaatcacggtgcccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccaatgctcgccg
gacctgcgcttctttctatgctccatgtacacgcccatctgtctgcccgactaccacaag
ccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgctcgccgctgatg
cgccagtacggcttcgcctggcccgagcgcatgagctgcgaccgcctcccggtgctgggc
cgcgacgccgaggtcctctgcatggattacaaccgcaccgaggccaccacggcgcccccc
aggcctttcccagccaagcccacccttccaggcccgccaggggcgccggcctcggggggc
gaatgccccgctgggggcccgtccgtgtgcaagtgtcgcgagcccttcgtgcccattctg
aaggagtcacacccgctctacaacaaggtgcggacgggccaggtgcccaactgcgcggta
ccctgttaccagccgtccttcagtgccgacgagcgcacgttcgccaccttctggataggc
ctgtggtcggtgctgtgcttcatctccacgtccaccacagtggccaccttcctcatcgac
atggaacgcttccgctatcctgagcgccccatcatcttcctgtcagcctgctacctgtgc
gtgtcgctgggcttcctagtgcgtctggtcgtgggccatgccagcgtggcctgcagccgc
gagcacaaccacatccactatgagaccacgggccctgcactgtgcaccatcgtcttcctt
ctggtctacttcttcggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcctggccgccggcatgaagtggggcaacgaggccatcgcgggctacgcgcagtacttc
cacctggctgcgtggctcatccccagcgtcaagtccatcacggcactggcgctgagctcc
gtggacggggacccagtggccggcatctgctacgtgggcaaccagaacctgaactcgctg
cgcggcttcgtgctgggcccgctggtgctctacctgctggtgggcacgctcttcctgctg
gcgggcttcgtgtcgctcttccgcatccgcagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaaactcatgatccgcatcggcatcttcacgctgctctacacggtgccc
gccagcattgtggtggcctgctacctgtacgagcagcactaccgcgagagctgggaggcg
gcgctcacctgcgcctgcccgggccccgacgccggccagccgcgcgccaagcccgagtac
tgggtgctcatgctcaagtacttcatgtgcctggtggtgggcatcacgtcgggcgtctgg
atctggtcgggcaagactgtggagtcgtggcggcgtttcaccagccgctgctgctgccgc
ccgcggcgcggccacaagagcgggggcgccatggccgccggggactaccctgaggcgagc
gccgcgctcacaggcaggaccgggccgccgggccccgccgccacctaccacaagcaggtg
tccctgtcgcacgtgtag

KEGG   Pongo abelii (Sumatran orangutan): 112135184
Entry
112135184         CDS       T01416                                 

Gene name
FZD8
Definition
(RefSeq) frizzled-8
  KO
K02375  frizzled 5/8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112135184 (FZD8)
   04390 Hippo signaling pathway
    112135184 (FZD8)
   04150 mTOR signaling pathway
    112135184 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112135184 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112135184 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112135184 (FZD8)
   05205 Proteoglycans in cancer
    112135184 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112135184 (FZD8)
   05226 Gastric cancer
    112135184 (FZD8)
   05217 Basal cell carcinoma
    112135184 (FZD8)
   05224 Breast cancer
    112135184 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112135184 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    112135184 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112135184 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112135184 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    112135184 (FZD8)
G protein-coupled receptors [BR:pon04030]
 Frizzled / Smoothened family
  112135184 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 PhaG_MnhG_YufB
Other DBs
NCBI-GeneID: 112135184
NCBI-ProteinID: XP_024109588
LinkDB
Position
10
AA seq 689 aa
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPPGEQPPSG
SGHGRPPGARPPHRGGGRGGGGGDAAAPPARGGGGGGKARPPGGGAAPCEPGCQCRAPMV
SVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTF
LIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGSAAAG
AGAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSL
TWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLD
NLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQDGPTKTHKLEKLMIRLGLFTVL
YTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGIT
SGVWVWSGKTLESWRSLCTRCCWASKGAAGGGGAGATAAGGGGGPGGVGGGGPGGGGGSL
YSDVSTGLTWRSGTASSVSYPKQMPLSQV
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgctgctggccgccttggcgctgctgcag
cgctctagcggcgcggcggccgcctcggccaaggagctggcatgccaagagatcaccgtg
ccgctgtgtaagggcatcggctacaactacacctacatgcccaaccagttcaaccacgac
acgcaggacgaggcgggcctggaggtgcaccagttctggccactggtggagatccagtgc
tcgcccgatctcaagttcttcctgtgcagcatgtacacgcccatctgcctggaggactac
aagaagccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggcttcgcctggcccgaccgcatgcgctgcgaccggctgcccgag
cagggcaaccctgatacgctgtgcatggactacaaccgcaccgacctcaccacagccgcg
cccagcccgccgcgccgcctgccgccgccgccgccgcccggcgagcagccgccttcgggc
agcggccacggccgcccgccgggggccaggcccccgcaccgcggcggcggcaggggcggt
ggcggcggggacgcggcggcgcccccagctcgcggcggcggcggtggcgggaaggcgcgg
ccccctggcggcggcgcggctccctgcgagcccgggtgccagtgccgcgcgcccatggtg
agcgtgtccagcgagcgccacccgctctacaaccgcgtcaagacaggccagatcgctaac
tgcgcgctgccctgccacaacccctttttcagccaggacgagcgcgccttcaccgtcttc
tggatcggcctgtggtcggtgctctgcttcgtgtccaccttcgccaccgtctccactttc
ctcatcgacatggagcgcttcaagtacccggagcggcccatcatcttcctctcggcctgc
tacctcttcgtgtcggtgggctacctagtgcgcctggtggcgggccacgagaaggtggca
tgcagcggtggcgcgccgggcgcggggggcgctgggggcgcgggcagcgcggcggctggc
gcgggcgcggcgggcgcgggcgcgggcggcccgggcgggcgcggcgagtacgaggagctg
ggcgcggtggagcagcacgtgcgctacgagaccaccggccccgcgctgtgcaccgtggtc
ttcttgctggtctacttcttcggcatggccagctccatctggtgggtgatcttgtcgctc
acgtggttcctggcggctggtatgaagtggggcaacgaagccatcgccggctactcgcag
tacttccacctggccgcgtggcttgtgcccagcgtcaagtccatcgcggtgctggcgctc
agctcggtggacggcgacccggtggcgggcatctgctacgtaggcaaccagagcctggac
aacctgcgcggcttcgtgctggcgccgctggtcatctacctcttcatcggcaccatgttc
ctgctggccggcttcgtgtccctcttccgcatccgctcggtcatcaagcaacaggacggc
cccaccaagacgcacaagctggagaagctgatgatccgcctgggcctgttcaccgtgctc
tacaccgtgcctgccgcggtggtggtcgcctgcctcttctacgagcagcacaaccgcccg
cgctgggaggccacgcacaactgcccgtgcctgcgggacctgcagcccgaccaggcacgc
aggcccgactacgccgtcttcatgctcaagtacttcatgtgcctagtggtgggcatcact
tcgggcgtgtgggtctggtccggcaagacgctggagtcctggcgctccctgtgcacccgc
tgctgctgggccagcaagggagccgcggggggcgggggcgcgggcgccacggccgcgggg
ggtggcggcgggccggggggcgtcggcggcgggggacccggcggcggcgggggctccctc
tacagcgacgtcagcaccggcctgacgtggcggtcgggcacggccagctccgtgtcttat
ccaaagcagatgccattgtcccaggtctga

DBGET integrated database retrieval system