KEGG   Pongo abelii (Sumatran orangutan): 100172184
Entry
100172184         CDS       T01416                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04114  Oocyte meiosis
pon04115  p53 signaling pathway
pon04218  Cellular senescence
pon04540  Gap junction
pon04914  Progesterone-mediated oocyte maturation
pon05170  Human immunodeficiency virus 1 infection
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100172184 (CDK1)
   04114 Oocyte meiosis
    100172184 (CDK1)
   04115 p53 signaling pathway
    100172184 (CDK1)
   04218 Cellular senescence
    100172184 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100172184 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100172184 (CDK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100172184 (CDK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100172184 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100172184 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pon03032]
    100172184 (CDK1)
   03036 Chromosome and associated proteins [BR:pon03036]
    100172184 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100172184 (CDK1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100172184 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100172184 (CDK1)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100172184 (CDK1)
DNA replication proteins [BR:pon03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100172184 (CDK1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100172184 (CDK1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100172184 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 100172184
NCBI-ProteinID: NP_001125286
Ensembl: ENSPPYG00000002421
UniProt: Q5RCH1
LinkDB
Position
10
AA seq 297 aa
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVTMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaagattataccaaaatagagaaaattggagaaggtacctatggagttgtgtataag
ggtagacacaaaactacaggtcaagtggtaaccatgaaaaaaatcagactagaaagtgaa
gaggaaggggttcctagtactgcaattcgggaaatttctctattaaaggaacttcgtcat
ccaaatatagtcagtcttcaggatgtgcttatgcaggattccaggttatatctcatcttt
gagtttctttccatggatctgaagaaatacttggattctatccctcctggtcagtacatg
gattcttcacttgttaagagttatttataccaaatcctacaggggattgtgttttgtcac
tctagaagagttcttcacagagacttaaaacctcaaaatctcttgattgatgacaaagga
acaattaaactggctgattttggccttgccagagcttttggaatacctatcagagtatat
acacatgaggtagtaacactctggtacagatctccagaagtattgctggggtcagctcgt
tactcaactccagttgacatttggagtataggcaccatatttgctgaactagcaactaag
aaaccacttttccatggggattcagaaattgatcaactcttcaggattttcagagctttg
ggcactcccaataatgaagtgtggccagaagtggaatctttacaggactataagaataca
tttcccaaatggaaaccaggaagcctagcatcccatgtcaaaaacttggatgaaaatggc
ttggatttgctctcgaaaatgttaatctatgatccagccaaacgaatttctggcaaaatg
gcactgaatcatccatattttaatgatttggacaatcagattaagaagatgtag

DBGET integrated database retrieval system