KEGG   Pongo abelii (Sumatran orangutan): 100172212
Entry
100172212         CDS       T01416                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04066  HIF-1 signaling pathway
pon04114  Oocyte meiosis
pon04217  Necroptosis
pon04261  Adrenergic signaling in cardiomyocytes
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04916  Melanogenesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04934  Cushing syndrome
pon04971  Gastric acid secretion
pon05012  Parkinson disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05031  Amphetamine addiction
pon05152  Tuberculosis
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05214  Glioma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100172212 (CAMK2A)
   04310 Wnt signaling pathway
    100172212 (CAMK2A)
   04066 HIF-1 signaling pathway
    100172212 (CAMK2A)
   04020 Calcium signaling pathway
    100172212 (CAMK2A)
   04024 cAMP signaling pathway
    100172212 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100172212 (CAMK2A)
   04217 Necroptosis
    100172212 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100172212 (CAMK2A)
   04922 Glucagon signaling pathway
    100172212 (CAMK2A)
   04912 GnRH signaling pathway
    100172212 (CAMK2A)
   04921 Oxytocin signaling pathway
    100172212 (CAMK2A)
   04916 Melanogenesis
    100172212 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    100172212 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100172212 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    100172212 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    100172212 (CAMK2A)
   04728 Dopaminergic synapse
    100172212 (CAMK2A)
   04720 Long-term potentiation
    100172212 (CAMK2A)
   04722 Neurotrophin signaling pathway
    100172212 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    100172212 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    100172212 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    100172212 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100172212 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172212 (CAMK2A)
   05205 Proteoglycans in cancer
    100172212 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    100172212 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100172212 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    100172212 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    100172212 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100172212 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100172212 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100172212 (CAMK2A)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100172212 (CAMK2A)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100172212 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 100172212
NCBI-ProteinID: NP_001125313
Ensembl: ENSPPYG00000015946
UniProt: Q5RCC4 A0A2J8X624
LinkDB
Position
5
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaattgggc
aagggagccttctcggtggttcgaaggtgtgtgaaggtgctggccggccaggagtatgct
gccaagatcatcaacacaaagaagctgtcagccagagaccatcagaagctggagcgtgaa
gcccgcatctgccgcctgctgaagcaccccaacatcgtccgactacatgacagcatctca
gaggagggacaccactacctgatcttcgacctggtcactggtggggaactgtttgaagat
atcgtggcccgggagtattacagtgaggcggatgccagtcactgtatccagcagatcctg
gaggctgtgctgcactgccaccagatgggggtggtgcaccgggacctgaagcctgagaat
ctgttgctggcctccaagctcaagggtgccgcagtgaagctggcagactttggcctggcc
atagaggtggagggggagcagcaggcatggtttgggtttgcagggactcctggatacctc
tccccagaagtgctgcggaaggacccgtacggaaagcctgtggacctgtgggcttgtggg
gtcatcctgtacatcctgctggttgggtaccccccgttctgggatgaggaccagcaccgc
ctgtaccagcagatcaaagccggcgcctatgatttcccatcgccggaatgggacaccgtc
accccggaagccaaggatctgatcaataagatgctgaccattaacccatccaaacgcatc
acagctgccgaagcccttaagcacccctggatctcgcaccgctccaccgtggcgtcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggaggaaactgaag
ggagccattctcaccacgatgctggccaccaggaacttctccggagggaagagtggggga
aacaagaagagcgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcctcagagagcaccaacaccaccatcgaggatgaagacaccaaagtgcggaaacaggaa
attataaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgcgaccctggcatgacagccttcgaacctgaggccctggggaacctggtt
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaagccc
gtgcacaccaccatcctgaatccccacatccacctgatgggcgacgagtcagcctgcatc
gcctacatccgcatcacgcagtacctggacgctggcggcatcccacgcaccgcccagtcg
gaggagacccgcgtctggcaccgccgggacggcaaatggcagatcgtccacttccacaga
tctggggcgccctccgtcctgccccactga

KEGG   Pongo abelii (Sumatran orangutan): 100433531
Entry
100433531         CDS       T01416                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04066  HIF-1 signaling pathway
pon04114  Oocyte meiosis
pon04217  Necroptosis
pon04261  Adrenergic signaling in cardiomyocytes
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04916  Melanogenesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04934  Cushing syndrome
pon04971  Gastric acid secretion
pon05012  Parkinson disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05031  Amphetamine addiction
pon05152  Tuberculosis
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05214  Glioma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100433531 (CAMK2B)
   04310 Wnt signaling pathway
    100433531 (CAMK2B)
   04066 HIF-1 signaling pathway
    100433531 (CAMK2B)
   04020 Calcium signaling pathway
    100433531 (CAMK2B)
   04024 cAMP signaling pathway
    100433531 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100433531 (CAMK2B)
   04217 Necroptosis
    100433531 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100433531 (CAMK2B)
   04922 Glucagon signaling pathway
    100433531 (CAMK2B)
   04912 GnRH signaling pathway
    100433531 (CAMK2B)
   04921 Oxytocin signaling pathway
    100433531 (CAMK2B)
   04916 Melanogenesis
    100433531 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    100433531 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100433531 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    100433531 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    100433531 (CAMK2B)
   04728 Dopaminergic synapse
    100433531 (CAMK2B)
   04720 Long-term potentiation
    100433531 (CAMK2B)
   04722 Neurotrophin signaling pathway
    100433531 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    100433531 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    100433531 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    100433531 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100433531 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100433531 (CAMK2B)
   05205 Proteoglycans in cancer
    100433531 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    100433531 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100433531 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100433531 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    100433531 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100433531 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100433531 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100433531 (CAMK2B)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100433531 (CAMK2B)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100433531 (CAMK2B)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 APH Kdo Pkinase_fungal SnoaL_4
Other DBs
NCBI-GeneID: 100433531
NCBI-ProteinID: XP_024105514
Ensembl: ENSPPYG00000017594
LinkDB
Position
7
AA seq 666 aa
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR
RGLGAPEAEGPLPCPSPAPFSPLPAPSTRISDILNSVRRGSGTPEAEGPLSVGPPPCLSP
ALLGPLPSPSPRISDILNSVRRGSGTPEAEGPSPVGTPPCPFPTIPGPLPTPSRKQEIIK
TTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHT
TILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGA
PVAPLQ
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgcttcaccgacgagtaccagctctacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccatgagtat
gcagccaagatcatcaacaccaagaagctgtcagccagagatcaccagaagctggagaga
gaggctcggatctgccgccttctgaagcattccaacattgtgcgtctccacgacagcatc
tccgaggagggcttccactacctggtcttcgatctggtcactggtggggagctctttgaa
gacattgtggcgagagagtactacagcgaggctgatgccagtcactgcatccagcagatc
ctggaggctgttctccattgtcaccaaatgggggtcgtccacagagacctcaagccggag
aacctgctcctggccagcaagtgcaaaggggctgcagtgaagctggcagacttcggcctg
gctatcgaggtgcagggggaccagcaggcatggtttgggttcgctggcacaccaggctac
ctgtcccctgaggtccttcgtaaagaggcgtatggcaagcccgtggacatttgggcatgt
ggggtgatcctgtacatcctgctcgtgggctacccacccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggctggtgcctatgacttcccgtcccctgagtgggacacc
gtcactcctgaagccaaaaacctcatcaaccagatgctgaccatcaaccctgccaagcgc
atcacagcccatgaggccctgaagcacccgtgggtctgccaacgctccacggtagcatcc
atgatgcacagacaggagactgtggagtgtctgaaaaagttcaatgccagaagaaagctc
aagggagccatcctcaccaccatgctggccacacggaatttctcagtgggcagacagacc
accgctccggccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaagcagatggagtcaagccccagacgaatagcaccaaa
aacagtgcagccgccaccagccccaaagggactcttcctcctgccgccctggagcctcaa
accaccgtcatccataacccagtggacgggattaaggagtcttctgacagtgccaacacc
accatagaggatgaagacgctaaagcccccagggtccccgacatcctgagctcagtgagg
aggggcttgggagccccagaagccgaggggcccctgccctgcccatctccggctcccttt
agccccctgccagccccatccaccaggatctctgacatcctgaactctgtgagaaggggc
tcaggaaccccagaagccgagggccccctctcagtggggcccccgccctgcctgtctccg
gctctcctaggccccttgccctccccgtcccccaggatctctgacatcctgaactctgtg
aggaggggctcagggaccccagaagccgagggcccctcgccagtggggaccccgccctgc
ccatttccgactatccctggccccctgcccaccccgtcccggaagcaggagatcattaag
accacggagcagctcatcgaggccgtcaacaacggtgactttgaagcctacgcgaaaatc
tgtgacccagggctgacctcgtttgagcctgaagcactgggcaacctggttgaagggatg
gacttccacagattctacttcgagaacctgctggccaagaacagcaagccgatccacacg
accatcctgaacccgcacgtgcacgtcatcggagaggacgccgcctgcatcgcttacatc
cggctcacgcagtacattgacgggcagggccggccccgcaccagccagtctgaggagacc
cgcgtgtggcaccgccgtgacggcaagtggcagaacgtgcacttccactgctcgggcgcg
cctgtggccccgctgcagtga

KEGG   Pongo abelii (Sumatran orangutan): 100436747
Entry
100436747         CDS       T01416                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04066  HIF-1 signaling pathway
pon04114  Oocyte meiosis
pon04217  Necroptosis
pon04261  Adrenergic signaling in cardiomyocytes
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04916  Melanogenesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04934  Cushing syndrome
pon04971  Gastric acid secretion
pon05012  Parkinson disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05031  Amphetamine addiction
pon05152  Tuberculosis
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05214  Glioma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100436747 (CAMK2D)
   04310 Wnt signaling pathway
    100436747 (CAMK2D)
   04066 HIF-1 signaling pathway
    100436747 (CAMK2D)
   04020 Calcium signaling pathway
    100436747 (CAMK2D)
   04024 cAMP signaling pathway
    100436747 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100436747 (CAMK2D)
   04217 Necroptosis
    100436747 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100436747 (CAMK2D)
   04922 Glucagon signaling pathway
    100436747 (CAMK2D)
   04912 GnRH signaling pathway
    100436747 (CAMK2D)
   04921 Oxytocin signaling pathway
    100436747 (CAMK2D)
   04916 Melanogenesis
    100436747 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    100436747 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100436747 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    100436747 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    100436747 (CAMK2D)
   04728 Dopaminergic synapse
    100436747 (CAMK2D)
   04720 Long-term potentiation
    100436747 (CAMK2D)
   04722 Neurotrophin signaling pathway
    100436747 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    100436747 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    100436747 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    100436747 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100436747 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100436747 (CAMK2D)
   05205 Proteoglycans in cancer
    100436747 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    100436747 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100436747 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    100436747 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    100436747 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100436747 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100436747 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100436747 (CAMK2D)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100436747 (CAMK2D)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100436747 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 100436747
NCBI-ProteinID: XP_024101591
Ensembl: ENSPPYG00000015013
LinkDB
Position
4
AA seq 533 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKINNKANVVTSPKENIPTPALEPQTTVIHNPDG
NKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALG
NLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKT
MQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQNI
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcttcgaccacaacctgcaccaggttcacggacgagtatcagcttttcgaggagctt
ggaaagggggcattctcagtggtgagaagatgtatgaaaattcctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactagaaaga
gaagctagaatttgccgtcttttgaagcaccctaatattgtgcgacttcatgatagcata
tcagaagagggctttcactacttggtgtttgatttagttactggaggtgaactgtttgaa
gacatagtggcaagagaatactacagtgaagctgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaattggcagactttggctta
gccatagaagttcaaggggaccagcaggcgtggtttggttttgctggcacacctggatat
ctttctccagaagttttacgtaaagatccttatggaaagccagtggatatgtgggcatgt
ggtgtcattctctatattctacttgtggggtatccacccttctgggatgaagaccagcac
agactctatcagcagatcaaggctggagcttatgattttccatcaccagaatgggacacg
gtgactcctgaagccaaagacctcatcaataaaatgcttactatcaaccctgccaaacgt
atcacagcctcagaggcactgaagcacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaaatttaatgctagaagaaaacta
aagggtgccatcttgacaactatgctggctacaaggaatttctcagcagccaagagtttg
ttgaagaaaccagatggagtaaagataaacaacaaagccaacgtggtaaccagccccaaa
gaaaatattcctaccccggcgctggaaccccaaactactgtaatccacaaccctgatgga
aacaaggagtcaactgagagttcaaatacaacaattgaggatgaagatgtgaaagcacga
aagcaagagattatcaaagtcactgaacaactgatcgaagctatcaacaatggggacttt
gaagcctacacaaaaatctgtgacccaggccttactgcttttgaacctgaagctttgggt
aatttagtggaagggatggattttcaccgattctactttgaaaatgctttgtccaaaagc
aataaaccaatccacactattattctaaaccctcatgtacatctggtaggggatgatgcc
gcctgcatagcatatattaggctcacacagtacatggatggcagtggaatgccaaagaca
atgcagtcagaagagactcgtgtgtggcaccgccgggatggaaagtggcagaatgttcat
tttcatcgctcggggtcaccaacagtacccatcaagccaccctgtattccaaatgggaaa
gaaaacttctcaggaggcacctctttgtggcaaaacatctaa

KEGG   Pongo abelii (Sumatran orangutan): 100462386
Entry
100462386         CDS       T01416                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04066  HIF-1 signaling pathway
pon04114  Oocyte meiosis
pon04217  Necroptosis
pon04261  Adrenergic signaling in cardiomyocytes
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04916  Melanogenesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04934  Cushing syndrome
pon04971  Gastric acid secretion
pon05012  Parkinson disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05031  Amphetamine addiction
pon05152  Tuberculosis
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05214  Glioma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100462386 (CAMK2G)
   04310 Wnt signaling pathway
    100462386 (CAMK2G)
   04066 HIF-1 signaling pathway
    100462386 (CAMK2G)
   04020 Calcium signaling pathway
    100462386 (CAMK2G)
   04024 cAMP signaling pathway
    100462386 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100462386 (CAMK2G)
   04217 Necroptosis
    100462386 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100462386 (CAMK2G)
   04922 Glucagon signaling pathway
    100462386 (CAMK2G)
   04912 GnRH signaling pathway
    100462386 (CAMK2G)
   04921 Oxytocin signaling pathway
    100462386 (CAMK2G)
   04916 Melanogenesis
    100462386 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    100462386 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100462386 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    100462386 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    100462386 (CAMK2G)
   04728 Dopaminergic synapse
    100462386 (CAMK2G)
   04720 Long-term potentiation
    100462386 (CAMK2G)
   04722 Neurotrophin signaling pathway
    100462386 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    100462386 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    100462386 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    100462386 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100462386 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462386 (CAMK2G)
   05205 Proteoglycans in cancer
    100462386 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    100462386 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100462386 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    100462386 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    100462386 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100462386 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100462386 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100462386 (CAMK2G)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100462386 (CAMK2G)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100462386 (CAMK2G)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr CaMKII_AD APH Pkinase_fungal Kdo RIO1
Other DBs
NCBI-GeneID: 100462386
NCBI-ProteinID: XP_024109934
Ensembl: ENSPPYG00000025863
LinkDB
Position
10
AA seq 617 aa
MGARHATHICSVSCGGRVLLLHVGWWWSQRRCVCMGAFSVVRRCVKKTSTQEYAAKIINT
KKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREY
YSEADASHCIHQILESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGE
QQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIK
AGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQET
VECLRKFNARRKLKGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSD
GGVKPQSNNKNSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAA
PLRTGNGNSVPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEA
YTKICDPGLTSFEPEALGNLVEGMDFHKFYFENREWVRAADILLPAPSPLCLCLLLTFSS
QLPTFPLFDLRAALLLCMLAPLCPDGCKQAPLKALLLSSKCHSFCSCLVAVPVTTVKLTY
FLLGAVAYACNPSTLGG
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgggagcgcggcacgccacccacatctgttcagtgtcctgcggtggccgcgtccttttg
cttcatgttggatggtggtggtcgcagcgccggtgtgtgtgcatgggtgctttctctgtg
gtccgcaggtgtgtgaagaaaacctccacgcaggagtacgcagcaaaaatcatcaatacc
aagaagttgtctgcccgggatcaccagaaactagaacgtgaggctcggatatgtcgactt
ctgaaacatccaaacatcgtgcgcctccatgacagtatttctgaagaagggtttcactac
ctcgtgtttgaccttgttaccggcggggagctgtttgaagacattgtggccagagagtac
tacagtgaagcagatgccagccactgtatacatcagattctggagagtgttaaccacatc
caccagcatgacatcgtccacagggacctgaagcctgagaacctgctgctggcgagtaaa
tgcaagggtgctgccgtcaagctggctgattttggcctagccatcgaagtacagggagag
cagcaggcttggtttggttttgctggcaccccaggttacttgtcccctgaggtcttgagg
aaagatccctatggaaaacctgtggatatctgggcctgcggggtcatcctgtatatcctc
ctggtgggctatcctcccttctgggatgaggatcagcacaagctgtatcagcagatcaag
gctggagcctatgatttcccatcaccagaatgggacacggtaactcctgaagccaagaac
ttgatcaaccagatgctgaccataaacccagcaaagcgcatcacggctgaccaggctctc
aagcacccgtgggtctgtcaacgatccacggtggcatccatgatgcatcgtcaggagact
gtggagtgtttgcgcaagttcaatgcccggagaaaactgaagggtgccatcctcacgacc
atgcttgtctccaggaacttctcagttggcaggcagagctccgcccccgcctcgcctgcc
gcgagcgccgccggcctggccgggcaagctgccaaaagcctattgaacaagaagtcggat
ggcggtgtcaagccacagagcaacaacaaaaacagtctcgtaagcccagcccaagagccc
gcgcccttgcagacggccatggagccacaaaccactgtggtacacaacgctacagatggg
atcaagggctccacagagagctgcaacacaaccacagaagatgaggacctcaaagctgcc
ccgctccgcactgggaatggcaactcggtgcctgaaggacggagctcccgggacagaaca
gccccctctgcaggcatgcagccccagccttctctctgctcctcagccatgcgaaaacag
gagatcattaagattacagaacagctgattgaagccatcaacaatggggactttgaggcc
tacacgaagatttgtgatccaggcctcacttcctttgagcctgaggcccttggtaacctc
gtggaggggatggatttccataagttttactttgagaatcgtgagtgggttcgtgctgct
gatatactcctgcctgccccttcacccctttgcctctgtctcctgcttaccttctcatcc
cagttgcccacttttcccttatttgaccttcgtgctgcactcctactctgtatgcttgcc
cccttgtgccccgatggttgtaaacaggcacctttgaaggccctgctcctgagctccaag
tgccattcattctgcagctgccttgtggcagtgccagtcaccacagtcaagctcacttat
ttcttgctgggcgcggtggcttacgcctgtaatcccagcactttgggaggctga

DBGET integrated database retrieval system