KEGG   Pongo abelii (Sumatran orangutan): 100172223
Entry
100172223         CDS       T01416                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 precursor
  KO
K05719  integrin beta 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04514  Cell adhesion molecules
pon04530  Tight junction
pon04611  Platelet activation
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05145  Toxoplasmosis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05222  Small cell lung cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100172223 (ITGB1)
   04151 PI3K-Akt signaling pathway
    100172223 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100172223 (ITGB1)
   04514 Cell adhesion molecules
    100172223 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100172223 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100172223 (ITGB1)
   04530 Tight junction
    100172223 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100172223 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100172223 (ITGB1)
   04670 Leukocyte transendothelial migration
    100172223 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    100172223 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172223 (ITGB1)
   05205 Proteoglycans in cancer
    100172223 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100172223 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100172223 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100172223 (ITGB1)
   05414 Dilated cardiomyopathy
    100172223 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100172223 (ITGB1)
   05133 Pertussis
    100172223 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    100172223 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100172223 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100172223 (ITGB1)
   05140 Leishmaniasis
    100172223 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100172223 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100172223 (ITGB1)
   04515 Cell adhesion molecules [BR:pon04515]
    100172223 (ITGB1)
   04090 CD molecules [BR:pon04090]
    100172223 (ITGB1)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100172223 (ITGB1)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100172223 (ITGB1)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin beta subunits
   100172223 (ITGB1)
CD molecules [BR:pon04090]
 Proteins
  100172223 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 100172223
NCBI-ProteinID: NP_001125324
UniProt: Q5RCA9
LinkDB
Position
10
AA seq 798 aa
MNLQPIFWIGLISSICCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPVKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGRRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAGHKECVQCRAFNKGEKKDT
CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttacaaccgattttctggattggactgatcagttcaatttgctgtgtgtttgct
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtgggtggtgcacaaattcaacatttttacaggaaggaatgcctact
tctgcacgctgtgatgatttagaagccttaaaaaagaagggttgtcctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacattaaaattcaagagagctgaagac
tatcccattgacctctactaccttatggacctgtcttactcaatgaaagacgatttggag
aatgtaaaaagtcttggaacagatctgatgaatgaaatgaggaggattacttcggacttc
agaattggatttggctcatttgtggaaaagactgtgatgccttacattagcacaacacca
gttaagctcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgctcagtcttactaataaaggagaagtatttaatgaacttgttggaaaacagcgc
atatctggaaatttggattctccagaaggtggttttgatgccatcatgcaagttgcagtt
tgtggatcactgattggccggaggaatgttacacggctgctggtgttttccacagatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacaa
tgtcacctggaaaataatatgtacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactgagtgaaaataatattcagacgatttttgcagttactgaagaa
tttcagcctgtttacaaggagctgaaaaacttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaatgtaattcagttgatcattgatgcatacaattccctttcctca
gaagtcattttggaaaacagcaaattgtcagaaggagtaacaataagttacaaatcttac
tgcaagaacggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataagtgtccaaaaaaggattct
gacagctttaaaattaggcctctgggctttacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgccaaagcgaaggcatccctgaaagtcccaagtgtcatgaagga
aacgggacatttgagtgtggagcgtgcaggtgcaatgaagggcgtgttggtagacattgt
gaatgcagcacagatgaagttaacagtgaagacatggacgcttactgcaggaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcgtctgcggacagtgtgtttgtaggaag
agggacaatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaaccccaactacactggcagtgcatgtgactgttctttggatactagtacttgtgaa
gccagcaacggacagatctgcaatggccggggcatctgcgagtgtggtgtctgtaagtgt
acagatccgaagtttcaagggcaaacgtgtgagatgtgtcagacctgccttggtgtctgt
gctgggcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgcacacaggaatgttcctattttaacattaccaaggtagaaagtcgggacaaattaccc
cagccagtccaacctgatcctgtgtcccattgtaaggagaaggatgttgacgactgttgg
ttctattttacgtattcagtgaatgggaacaacgaggtcatggttcatgttgtggagaat
ccagagtgtcccactggtccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgataattcatgacaga
agggagtttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgccgtgacaactgtggtcaatccaaagtatgagggaaaatga

DBGET integrated database retrieval system