KEGG   Pongo abelii (Sumatran orangutan): 100172245
Entry
100172245         CDS       T01416                                 

Gene name
CSNK1D
Definition
(RefSeq) casein kinase I isoform delta
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04340  Hedgehog signaling pathway
pon04390  Hippo signaling pathway
pon04540  Gap junction
pon04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100172245 (CSNK1D)
   04390 Hippo signaling pathway
    100172245 (CSNK1D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100172245 (CSNK1D)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100172245 (CSNK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100172245 (CSNK1D)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100172245 (CSNK1D)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100172245 (CSNK1D)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   100172245 (CSNK1D)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100172245 (CSNK1D)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 100172245
NCBI-ProteinID: NP_001125343
UniProt: Q5RC72
LinkDB
Position
17
AA seq 415 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKPPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTILLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggagctgagagtcgggaacaggtaccggctgggccggaagatcggcagcggctccttc
ggagacatctatctcggtacggacattgctgcaggagaagaggttgccatcaagcttgaa
tgtgtcaaaaccaaaccccctcagctccacattgagagcaaaatctacaagatgatgcag
ggaggagtgggcatccccaccatcagatggtgcggggcagagggggactacaacgtcatg
gtgatggagctgctggggccaagcctggaggacctcttcaacttctgctccaggaaattc
agcctcaaaaccatcctgctgcttgctgaccaaatgatcagtcgcatcgaatacattcat
tcaaagaacttcatccaccgggatgtgaagccagacaacttcctcatgggcctggggaag
aagggcaacctggtgtacatcatcgacttcgggctggccaagaagtaccgggacgcacgc
acccaccagcacatcccctatcgtgagaacaagaacctcacggggacggcgcggtacgcc
tccatcaacacgcaccttggaattgaacaatcccgaagagatgacttggagtctctgggc
tacgtgctaatgtacttcaacctgggctctctcccctggcaggggctgaaggccgccacc
aagagacagaaatatgaaaggattagcgagaagaaaatgtccacccccatcgaagtgctg
tgtaaaggctacccttctgaatttgccacatacctgaatttctgccgttccttgcgtttt
gacgacaagcctgactactcgtacctgaggcagcttttccggaatctgttccatcgccag
ggcttctcttatgactacgtgttcgactggaacatgctcaaatttggtgccagccgggcc
gctgacgatgctgagcgggagcgcagggaccgagaggagcggctgagacactcgcggaac
ccggctacccgcggcctcccttccacagcctccggccgcctgcgggggacgcaggaagtg
gctccccccacacccctcacccctacctcacacacggctaacacctccccccggcctgtc
tcgggcatggagagagagcggaaagtgagtatgcggttgcaccgcggggcccccgtcaac
atctcctcgtccgacctcacaggccgacaagatacctctcgcatgtccacctcacagatt
cctggtcgggtggcttccagtggtcttcagtctgtcgtgcaccgatga

DBGET integrated database retrieval system