KEGG   Pongo abelii (Sumatran orangutan): 100172246Help
Entry
100172246         CDS       T01416                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00051  Fructose and mannose metabolism
pon00052  Galactose metabolism
pon00500  Starch and sucrose metabolism
pon00520  Amino sugar and nucleotide sugar metabolism
pon00524  Neomycin, kanamycin and gentamicin biosynthesis
pon01100  Metabolic pathways
pon01200  Carbon metabolism
pon04066  HIF-1 signaling pathway
pon04910  Insulin signaling pathway
pon04930  Type II diabetes mellitus
pon04973  Carbohydrate digestion and absorption
pon05230  Central carbon metabolism in cancer
Module
pon_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pon_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100172246 (HK1)
   00051 Fructose and mannose metabolism
    100172246 (HK1)
   00052 Galactose metabolism
    100172246 (HK1)
   00500 Starch and sucrose metabolism
    100172246 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100172246 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100172246 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100172246 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100172246 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100172246 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100172246 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100172246 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100172246 (HK1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100172246 (HK1)
Membrane trafficking [BR:pon04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100172246 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 100172246
NCBI-ProteinID: NP_001125344
Ensembl: ENSPPYG00000002383
UniProt: Q5RC71
LinkDB All DBs
Position
10
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKSPVGFTFSFPCQQSKIDEAVLITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAAVKMLPSFVRRTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGNDVATLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRTEASS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcacggagctgaaggatgaccaggtcaaa
aagattgacaagtatctctatgccatgcggctctctgatgaaactctcatagatatcatg
actcgcttcaggaaggagatgaagaatggcctctcccgggattttaatccaacagccaca
gtcaagatgttgccaacattcgtaaggtccattcctgatggctctgaaaagggagatttc
attgccctggatcttggtgggtcttcctttcgaattctgcgggtgcaagtgaatcatgag
aaaaaccagaatgttcacatggagtccgaggtttatgacaccccagagaacatcgtgcac
ggcagtggaagccagctttttgatcatgttgctgagtgcctgggagatttcatggagaaa
aggaagatcaaggacaagaagtcacctgtgggattcacgttttcttttccttgtcagcaa
tccaaaatagacgaggccgtcttgatcacctggacaaagcgatttaaagcgagcggagtg
gaaggagcagatgtggtcaagctgcttaacaaagccatcaaaaagcgaggggactatgat
gccaacatcgtagctgtggtgaatgacacagtgggcaccatgatgacctgtggctatgac
gaccagcattgtgaagtcggcctgatcatcggcactggcaccaatgcttgctacatggag
gaactgaggcacattgatctggtggaaggagacgaggggaggatgtgtatcaacacggaa
tggggagcctttggagacgatggatcattagaagacatccggacagagtttgacagggag
atagaccggggatccctcaaccctggaaaacagctgtttgagaagatggtcagtggcatg
tacttgggagagctggttcgactgatcctagtcaagatggccaaggagggcctcttattt
gaagggcggatcaccccggagctgctcaccagagggaagtttaacactagtgatgtgtca
gccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccgtccgatgatgactgtgtctcggtccagcacgtttgcaccattgtctcattt
cgctcagccaacctggtggctgccacgctgggcgccatcttgaaccgcctgcgtgataac
aagggcacacccaggctgcggaccacggttggtgtcgacggatctctttacaagacgcac
ccacagtattcccggcgtttccacaagactctgaggcgcttggtgccggactccgatgtg
cgcttcctcctctcggagagtggcagcggcaagggggctgccatggtgacggcggtggcc
taccgcttggccgagcagcaccggcagatagaggagaccctggctcatttccacctcacc
aaggacatgctgctggaggtgaagaagaggatgcgggccgagatggagctggggctgagg
aaacagacgcacaacaatgccgcggttaagatgctgccctccttcgtccggagaactccc
gacgggaccgaaaatggtgacttcttggccctggatcttggaggaaccaatttccgtgtg
ctgctggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcacaacaagatctac
gccattcctattgaaatcatgcagggcactggggaagagctgtttgatcacattgtctcc
tgcatctctgacttcctggactacatggggatcaaaggccccaggatgcctctgggcttc
acgttctcatttccctgcaagcagacgagtctggacgcgggaatcttgatcacgtggaca
aagggttttaaggcaacagactgcgtgggcaatgatgtagccaccttactaagggatgcg
ataaaaaggagagaggaatttgacctggacgtggtggctgtggtcaacgacacagtgggc
accatgatgacctgtgcttatgaggagcccacctgtgaggtcggactcattgttgggacc
ggcagcaatgcctgctacatggaggagatgaagaacgtggagatggtggagggggaccag
gggcagatgtgcatcaacatggagtggggggcctttggggacaacgggtgtctggatgat
atcaggacacactacgacagactggtggacgaatattccctaaatgccgggaaacaaagg
tatgagaagatgatcagtggtatgtacctgggtgaaatcgtccgcaacatcttaatcgac
ttcaccaagaagggatttctcttccgagggcagatctctgagccgctgaagacccggggc
atctttgagaccaagtttctctctcagatcgagagtgaccgattagcactgctccaggtc
cgggctatcctccagcagctgggtctgaatagcacctgcgatgacagtatcctcgtcaag
acagtgtgcggggtggtgtccaggagggctgcgcagctgtgtggcgcaggcatggctgca
gtggtggataagatccgcgagaacagaggactggaccgtctgaatgtgactgtgggagtg
gacgggacgctctacaagcttcatccgcacttctccagaatcatgcaccagacggtgaag
gaactgtcaccaaaatgtaacgtgtctttcctcctgtctgaggatggcagcggcaagggg
gccgccctcatcacggccgtgggtgtgcggttacgcacagaggcaagcagctaa

DBGET integrated database retrieval system