KEGG   Pongo abelii (Sumatran orangutan): 100172271
Entry
100172271         CDS       T01416                                 

Gene name
MYL12A
Definition
(RefSeq) myosin regulatory light chain 12A
  KO
K12757  myosin regulatory light chain 12
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04530  Tight junction
pon04611  Platelet activation
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100172271 (MYL12A)
   04530 Tight junction
    100172271 (MYL12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100172271 (MYL12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100172271 (MYL12A)
   04670 Leukocyte transendothelial migration
    100172271 (MYL12A)
  09158 Development and regeneration
   04360 Axon guidance
    100172271 (MYL12A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100172271 (MYL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100172271 (MYL12A)
   04147 Exosome [BR:pon04147]
    100172271 (MYL12A)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100172271 (MYL12A)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100172271 (MYL12A)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 SPARC_Ca_bdg DUF2666 DUF3741
Other DBs
NCBI-GeneID: 100172271
NCBI-ProteinID: NP_001125368
Ensembl: ENSPPYG00000009033
UniProt: Q5RC34 A0A140TAX1
LinkDB
Position
18
AA seq 177 aa
MDLTTTMSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLH
DMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEAT
GTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 534 nt   +upstreamnt  +downstreamnt
atggatttaaccaccaccatgtcgagcaaaagaacaaagaccaagaccaagaagcgccct
cagcgtgcaacatccaatgtgtttgctatgtttgaccagtcacagattcaggagttcaaa
gaggcctttaacatgattgatcagaacagagatggtttcatcgacaaggaagatttgcat
gatatgcttgcttcattggggaagaatccaactgatgagtatctagatgccatgatgaat
gaggctccaggccccatcaatttcaccatgttcctcaccatgtttggtgagaagttaaat
ggcacagatcctgaagatgtcatcagaaatgcctttgcttgctttgatgaagaagcaact
ggcaccattcaggaagattacttgagagagctgctgacaaccatgggggatcggtttacg
gatgaggaagtggatgagctgtacagagaagcacctattgataaaaaggggaatttcaat
tacatcgagttcacacgcatcctgaaacatggagcaaaagacaaagatgactga

KEGG   Pongo abelii (Sumatran orangutan): 100172462
Entry
100172462         CDS       T01416                                 

Gene name
MYL9
Definition
(RefSeq) myosin regulatory light polypeptide 9
  KO
K12755  myosin regulatory light chain 9
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04270  Vascular smooth muscle contraction
pon04360  Axon guidance
pon04510  Focal adhesion
pon04530  Tight junction
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon04921  Oxytocin signaling pathway
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100172462 (MYL9)
   04022 cGMP-PKG signaling pathway
    100172462 (MYL9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100172462 (MYL9)
   04530 Tight junction
    100172462 (MYL9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100172462 (MYL9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100172462 (MYL9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100172462 (MYL9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100172462 (MYL9)
  09158 Development and regeneration
   04360 Axon guidance
    100172462 (MYL9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100172462 (MYL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100172462 (MYL9)
   04147 Exosome [BR:pon04147]
    100172462 (MYL9)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100172462 (MYL9)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   100172462 (MYL9)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 100172462
NCBI-ProteinID: NP_001125549
Ensembl: ENSPPYG00000010971
UniProt: Q5RBA4 A0A2J8VJH4
LinkDB
Position
20
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccagcaagcgggccaaagccaagaccaccaagaagcggccacagcgggccacatcc
aatgtcttcgcaatgtttgaccagtcccagatccaggagtttaaggaggctttcaacatg
attgaccagaaccgtgatggcttcattgacaaggaggacctgcacgacatgctggcctcg
ctggggaagaaccccacagacgaatacctggagggcatgatgagcgaggccccggggccc
atcaacttcaccatgttcctcaccatgtttggggagaagctgaacggcacggaccccgag
gatgtgattcgcaacgcctttgcctgcttcgacgaggaagcctcaggtttcatccatgag
gaccacctccgggagctgctcaccaccatgggtgaccgcttcacagatgaggaagtggat
gagatgtaccgggaggcgcccattgataagaaaggcaacttcaactacgtggagttcacc
cgcatcctcaaacatggcgccaaggataaagacgactag

KEGG   Pongo abelii (Sumatran orangutan): 100432987
Entry
100432987         CDS       T01416                                 

Definition
(RefSeq) myosin regulatory light chain 12B isoform X1
  KO
K12757  myosin regulatory light chain 12
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04530  Tight junction
pon04611  Platelet activation
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100432987
   04530 Tight junction
    100432987
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100432987
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100432987
   04670 Leukocyte transendothelial migration
    100432987
  09158 Development and regeneration
   04360 Axon guidance
    100432987
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100432987
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100432987
   04147 Exosome [BR:pon04147]
    100432987
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100432987
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100432987
SSDB
Motif
Pfam: EF-hand_11 EF-hand_7 EF-hand_8
Other DBs
NCBI-GeneID: 100432987
NCBI-ProteinID: XP_009238768
LinkDB
Position
4
AA seq 174 aa
MLSKKAKTKTTKKRPQCATSNAFAMFDQSQIQEFKEDFNMIDQNRDKGFINNKEDLRGIL
APLGKNPTDACLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEAAAGTI
QEDYLRELLTTMGDQFTDEKVDELYREAPIDKKGNFNYIEFTSILKHGVKDKDD
NT seq 525 nt   +upstreamnt  +downstreamnt
atgttgagcaaaaaggcaaagaccaagaccaccaagaagcgccctcagtgcgcaacatcc
aatgcgtttgccatgtttgaccagtcacagattcaggagttcaaagaggacttcaacatg
attgatcagaacagagataaaggtttcatcaacaacaaggaagatttgcgtggtatactt
gctcctctagggaagaatcccactgatgcatgccttgatgccatgatgaatgaggcacca
gggcccattaatttcaccatgttcctcaccatgtttggtgagaagttaaatggcacagat
cctgaagatgtcatcagaaatgcttttgcttgctttgatgaagcagcagcaggcaccatt
caggaagattacctgagagagctgctgacaaccatgggggatcagtttacagatgagaaa
gtggatgagctgtacagagaagcacctattgacaaaaaggggaatttcaattacatcgag
ttcacaagcatcctgaaacatggagtaaaagacaaagatgactga

KEGG   Pongo abelii (Sumatran orangutan): 100442785
Entry
100442785         CDS       T01416                                 

Gene name
MYL10
Definition
(RefSeq) myosin regulatory light chain 10
  KO
K12756  myosin regulatory light chain 10
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04510  Focal adhesion
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100442785 (MYL10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100442785 (MYL10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100442785 (MYL10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100442785 (MYL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100442785 (MYL10)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100442785 (MYL10)
SSDB
Motif
Pfam: EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_5 TC1
Other DBs
NCBI-GeneID: 100442785
NCBI-ProteinID: XP_002817850
Ensembl: ENSPPYG00000017450
UniProt: H2PLS8 A0A663DEA6
LinkDB
Position
7
AA seq 226 aa
MLLRLVSNSWSQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLA
LSPRLECNGVISAHGNLRLMGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRIN
VKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIK
EKLMTQADRFSEEEVKQMFAAFPPDVYGNLDYRNLCYVITHGEEKD
NT seq 681 nt   +upstreamnt  +downstreamnt
atgttgcttaggctggtctcaaactcctggtctcaagtgatcctccctcctcggcctccc
aaagtgctgggattacaggcaccgagaagagctcggaaaagagcagaaggcaccgccagc
tccaacgtcttctccatgtttgatcagtcccagatccaggagtttaaagagagtctggct
ctgtcgcccaggctggagtgcaatggcgtgatctcagctcacggcaacctccgcctcatg
ggttcaagcaattctcctgcctcagcctctcaagctttcaccatcatggaccagaaccgc
gatggcttcatcgacaaagaggacttgagggacacctttgccgcgctgggccgcatcaat
gtcaagaacgaggaactggaggccatggtgaaggaggcccccggacccatcaacttcacg
gtgttcctgaccatgtttggggagaagctgaagggcacggacccagaggagaccattctt
cacgccttcaaagtgttcgacactgaagggaaaggtttcgtcaaggccgatgtcatcaaa
gaaaaacttatgacccaggcagaccgcttcagtgaggaggaggtcaagcagatgtttgca
gcgtttcccccagatgtgtacggcaacctggactacagaaacctgtgctacgtcatcact
catggtgaagagaaggattag

KEGG   Pongo abelii (Sumatran orangutan): 100449813
Entry
100449813         CDS       T01416                                 

Gene name
MYLPF
Definition
(RefSeq) myosin regulatory light chain 2, skeletal muscle isoform
  KO
K12758  fast skeletal myosin light chain 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04510  Focal adhesion
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100449813 (MYLPF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100449813 (MYLPF)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100449813 (MYLPF)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100449813 (MYLPF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100449813 (MYLPF)
   04147 Exosome [BR:pon04147]
    100449813 (MYLPF)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100449813 (MYLPF)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   100449813 (MYLPF)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 100449813
NCBI-ProteinID: XP_024089736
Ensembl: ENSPPYG00000007269
LinkDB
Position
16
AA seq 169 aa
MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcacccaagagggccaagagaaggacagtagagggcggaagctccagcgtcttctcc
atgttcgaccagactcagatccaggagttcaaagaggccttcaccgtgatcgaccagaac
cgtgatggtattatagacaaggaggaccttcgggacaccttcgcagccatgggccgcctc
aatgtgaagaatgaggagttggatgccatgatgaaggaagccagcggtcccatcaacttc
actgtcttcctgaccatgtttggggagaagctcaagggtgccgaccctgaggatgtgatc
actggagccttcaaggtcctggaccccgagggaaagggcaccatcaagaagaagttcctg
gaggagctgctgaccacgcagtgtgaccgcttctcccaggaggagatcaagaacatgtgg
gcggccttcccccccgacgtgggcggcaacgtcgactacaaaaacatctgctacgtcatc
acgcacggcgacgccaaggaccaggaatag

KEGG   Pongo abelii (Sumatran orangutan): 100450310
Entry
100450310         CDS       T01416                                 

Definition
(RefSeq) myosin regulatory light chain 12B
  KO
K12757  myosin regulatory light chain 12
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04530  Tight junction
pon04611  Platelet activation
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100450310
   04530 Tight junction
    100450310
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100450310
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100450310
   04670 Leukocyte transendothelial migration
    100450310
  09158 Development and regeneration
   04360 Axon guidance
    100450310
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100450310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100450310
   04147 Exosome [BR:pon04147]
    100450310
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100450310
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100450310
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 SPARC_Ca_bdg DUF2666 DUF3741 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 100450310
NCBI-ProteinID: XP_002828122
Ensembl: ENSPPYG00000009032
UniProt: A0A6D2WX35 A0A2J8XGQ4
LinkDB
Position
18
AA seq 172 aa
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcaagcaaaaaggcaaagaccaagaccaccaagaagcgccctcagcgtgcaacatcc
aatgtgtttgccatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatg
attgatcagaatagagatggcttcatcgacaaggaagatttgcatgatatgcttgcttct
ctagggaagaatcccactgatgcataccttgatgccatgatgaatgaggcaccagggccc
atcaatttcaccatgttcctgaccatgtttggtgagaagttaaatggcacagatcctgaa
gatgtcatcagaaacgcctttgcttgctttgatgaagaagcaacaggtaccattcaggaa
gattacctgagagagctgctgacaaccatgggggatcggtttacggatgaggaagtggat
gagctgtacagagaagcacctattgacaaaaaggggaatttcaattacatcgagttcaca
cgcatcctgaaacatggagccaaagacaaagatgactga

KEGG   Pongo abelii (Sumatran orangutan): 100455740
Entry
100455740         CDS       T01416                                 

Gene name
MYL5
Definition
(RefSeq) myosin light chain 5 isoform X2
  KO
K12753  myosin regulatory light chain 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100455740 (MYL5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100455740 (MYL5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100455740 (MYL5)
  09158 Development and regeneration
   04360 Axon guidance
    100455740 (MYL5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100455740 (MYL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100455740 (MYL5)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100455740 (MYL5)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_4
Other DBs
NCBI-GeneID: 100455740
NCBI-ProteinID: XP_002814535
UniProt: A0A2J8SSF7
LinkDB
Position
4
AA seq 132 aa
MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDA
EETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDAAGNLDYKAL
SYVITHGEEKEE
NT seq 399 nt   +upstreamnt  +downstreamnt
atggatcagaaccgagatggcttcattgacaaggaggacctgaaggacacctacgcctcc
ctgggcaagaccaacgtcaaggacgacgagctggatgccatgctcaaagaggcctcaggg
cccatcaacttcaccatgtttctgaacctgtttggggagaagctgagcggtaccgacgcc
gaggagaccattctaaacgccttcaagatgctggacccggacggaaaagggaaaatcaac
aaggagtacatcaagcgtctgctgatgtcccaggctgacaagatgacagcggaagaggtg
gaccagatgttccagttcgcttccatcgatgcggcgggcaacctggactacaaggcgctc
agctacgtgatcacccacggggaggagaaggaggagtga

KEGG   Pongo abelii (Sumatran orangutan): 100462280
Entry
100462280         CDS       T01416                                 

Gene name
MYL2
Definition
(RefSeq) myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  KO
K10351  myosin regulatory light chain 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04260  Cardiac muscle contraction
pon04261  Adrenergic signaling in cardiomyocytes
pon04371  Apelin signaling pathway
pon04510  Focal adhesion
pon04530  Tight junction
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
pon05410  Hypertrophic cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100462280 (MYL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100462280 (MYL2)
   04530 Tight junction
    100462280 (MYL2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100462280 (MYL2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100462280 (MYL2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100462280 (MYL2)
   04261 Adrenergic signaling in cardiomyocytes
    100462280 (MYL2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100462280 (MYL2)
   05414 Dilated cardiomyopathy
    100462280 (MYL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100462280 (MYL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100462280 (MYL2)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100462280 (MYL2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 100462280
NCBI-ProteinID: XP_024112581
Ensembl: ENSPPYG00000004957
LinkDB
Position
12
AA seq 166 aa
MAPKKAKKRTGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADAEETILNAFKVFDPEGKGVLKADYVR
DMLTTQAERFSKEEVEQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcacctaagaaagcaaagaagagaacggggggcgccaactccaacgtgttctccatg
ttcgaacagacccaaatccaggaatttaaggaggccttcactatcatggaccagaacagg
gatggcttcatcgacaagaacgatctgagagacacctttgctgcccttgggcgtgtgaac
gtgaaaaacgaagaaattgatgaaatgatcaaggaggctccgggtccaattaactttact
gtgttcctcacaatgtttggggagaaacttaagggagcggacgctgaggaaaccattctc
aacgcattcaaagtgtttgaccctgaaggcaaaggggtgctgaaggctgattatgttcgg
gacatgctgaccacgcaggcggagaggttttccaaggaggaggttgaacagatgttcgct
gccttcccccctgacgtgactggcaacttggactacaagaacctggtgcacatcatcacc
cacggagaagagaaggactag

KEGG   Pongo abelii (Sumatran orangutan): 112134321
Entry
112134321         CDS       T01416                                 

Gene name
MYL7
Definition
(RefSeq) myosin regulatory light chain 2, atrial isoform isoform X1
  KO
K12754  myosin regulatory light chain 7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04510  Focal adhesion
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112134321 (MYL7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112134321 (MYL7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    112134321 (MYL7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112134321 (MYL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    112134321 (MYL7)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112134321 (MYL7)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9
Other DBs
NCBI-GeneID: 112134321
NCBI-ProteinID: XP_024105555
LinkDB
Position
7
AA seq 198 aa
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEASPPPPTFSRAGGCSHLKAPI
PQAFSCIDQNRDGFICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEK
LNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGN
IDYKSLCYIITHGDEKEE
NT seq 597 nt   +upstreamnt  +downstreamnt
atggccagcaggaaggcggggacccggggcaaggtggcagccaccaagcaggcccagcgt
ggttcttccaacgtcttttccatgtttgaacaagcccagatccaggagttcaaggaagcc
tctcccccacctcccaccttctctagagctgggggctgctcccacctgaaggcccccatc
ccacaggccttcagctgtatcgaccagaatcgtgatggcttcatctgcaaggcagacctg
agggagacctactcccagctagggaaggtgagtgtcccagaggaggagctggacgccatg
ctgcaggagggcaagggccccatcaacttcaccgtcttcctcacgctctttggggaaaag
ctcaatgggacagaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagc
ggcaaaggggtggtgaacaaggatgagttcaagcagcttctcctgacccaggcagacaag
ttctctccagctgaggtggagcagatgttcgccctgacgcccatggacctggcagggaac
atcgactacaagtcactgtgctatatcatcacccatggagacgagaaagaggaataa

DBGET integrated database retrieval system