KEGG   Pongo abelii (Sumatran orangutan): 100172349Help
Entry
100172349         CDS       T01416                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04146  Peroxisome
pon04213  Longevity regulating pathway - multiple species
pon05014  Amyotrophic lateral sclerosis (ALS)
pon05016  Huntington disease
pon05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100172349 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100172349 (SOD1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100172349 (SOD1)
   05016 Huntington disease
    100172349 (SOD1)
   05020 Prion diseases
    100172349 (SOD1)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100172349 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 100172349
NCBI-ProteinID: NP_001125441
Ensembl: ENSPPYG00000011354
LinkDB All DBs
Position
21
AA seq 155 aa AA seqDB search
MATKAVCVLKGDNSPVKGIINFEQKERNGPVKVWGSIEGLTEGLHGFHVHEFGDNTVGCT
SAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVVSVSIEDSVISLSGDHCIIGRTLV
VHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaaggccgtgtgcgtgctgaagggcgacaacagcccagtgaagggcatcatc
aatttcgagcagaaggaacgtaatggaccagtgaaggtgtggggaagcattgaaggactg
actgaaggcctgcatggattccatgttcatgagtttggagataatacagtaggctgtacc
agtgcaggtcctcactttaatcctctatccagaaaacacggtgggccaaaggatgaagag
aggcatgttggagacttgggcaacgtgactgctgacaaagatggtgtggtcagtgtgtct
attgaagattctgtgatctcactctcaggagaccactgcattattggccgcacgttggtg
gtccatgaaaaagcagatgacttgggcaaaggtggaaatgaagaaagtacaaagacagga
aacgctggaagtcgtttggcttgtggtgtaattgggatcgcccaataa

DBGET integrated database retrieval system