KEGG   Pongo abelii (Sumatran orangutan): 100172358
Entry
100172358         CDS       T01416                                 

Gene name
LYPLA1
Definition
(RefSeq) acyl-protein thioesterase 1
  KO
K06128  lysophospholipase I [EC:3.1.1.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100172358 (LYPLA1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100172358 (LYPLA1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100172358 (LYPLA1)
SSDB
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_1 Abhydrolase_3 Abhydrolase_6 Cutinase Palm_thioest FSH1 DUF2974 DLH Esterase Esterase_PHB Lipase_3 DUF2920
Other DBs
NCBI-GeneID: 100172358
NCBI-ProteinID: NP_001125450
Ensembl: ENSPPYG00000018590
UniProt: Q5RBR7 A0A2J8UN68
LinkDB
Position
8
AA seq 230 aa
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRP
VTLNMNMAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLM
FGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
NT seq 693 nt   +upstreamnt  +downstreamnt
atgtgcggcaataacatgtcaaccccgctgcccgccatcgtgcccgccgcccggaaggcc
accgctgcggtgattttcctgcatggattgggagatactgggcacggatgggcagaagcc
tttgcaggtatcagaagttcacatatcaaatatatctgcccgcatgcgcctgttaggcct
gttacattaaatatgaacatggctatgccttcatggtttgatattattgggctttcacca
gattcacaggaggatgaatctgggattaaacaggcagcagaaaatataaaagctttgatt
gatcaagaagtgaagaatggcattccttctaacagaattattttgggagggttttctcag
ggaggagctttatctttatatactgcccttaccacgcagcagaaactggcaggtgtcact
gcactcagttgctggcttccacttcgggcttcctttccacagggtcctatcggtggtgct
aatagagatatttctatcctccagtgccacggggattgtgaccctttagttcccctgatg
tttggttctcttacggttgaaaaactaaaaacattggtgaatccagccaatgtgaccttt
aaaacctatgaaggtatgatgcacagttcgtgtcaacaggaaatgatggatgtcaagcaa
ttcattgataaactcctacctccaattgattga

DBGET integrated database retrieval system