KEGG   Pongo abelii (Sumatran orangutan): 100172456
Entry
100172456         CDS       T01416                                 

Gene name
DGKA
Definition
(RefSeq) diacylglycerol kinase alpha
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100172456 (DGKA)
   00564 Glycerophospholipid metabolism
    100172456 (DGKA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100172456 (DGKA)
   04072 Phospholipase D signaling pathway
    100172456 (DGKA)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100172456 (DGKA)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     100172456 (DGKA)
SSDB
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 C1_2 EF-hand_8 NAD_kinase
Other DBs
NCBI-GeneID: 100172456
NCBI-ProteinID: NP_001125544
Ensembl: ENSPPYG00000004636
UniProt: A0A2J8UI10 Q5RBB2
LinkDB
Position
12
AA seq 735 aa
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIY
LEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLSDVSCYFSLLEGGRPEDKLEFTFK
LYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEW
VRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKY
TVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHC
VWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNL
STSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPVSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQ
NLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIM
REKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVL
NIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLE
GAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPML
MGPPPRSTNFFGFLS
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggccaaggagaggggcctaataagccccagtgattttgcccagctgcaaaaatacatg
gaatactccaccaaaaaggtcagtgatgtcctaaagctcttcgaggatggcgagatggct
aaatatgtccaaggagatgccattgggtacgagggattccagcaattcctgaaaatctat
ctggaagtggataatgtccccagacacctaagcctggcactgtttcaatcctttgagact
ggtcactgcttaaatgagacaaatgtgacaaaagatgtggtgtgtctcagtgatgtttcc
tgctacttttcccttctggagggtggtcggccagaagacaagttagaattcaccttcaag
ctgtacgacacggacagaaatgggatcctggacagctcagaagtggacaaaattatccta
cagatgatgcgagtggctgaatacctggattgggatgtgtctgagctgaggccgattctc
caggagatgatgaaagagattgactatgatgggagtggctctgtctctcaagctgagtgg
gtccgggctggggccaccaccgtgccactgctagtgctgctgggtctggagatgactctg
aaggacgatggacagcacatgtggaggcccaagaggttccccagaccagtctactgcaat
ctgtgcgagtcaagcattggtcttggcaaacagggactgagctgtaacctctgtaagtac
actgttcacgaccagtgtgccatgaaagccctgccttgtgaagtcagcacctatgccaag
tctcggaaggacattggtgtccaatcacatgtgtgggtgcgaggaggctgtgagtccggg
cgctgcgaccgctgtcagaaaaagatccggatctaccacagtctgacggggctgcattgt
gtatggtgccacctagagatccacgatgactgcctgcaagcggtgggccatgagtgtgac
tgtgggctgctccgggatcacatcctgcctccatcttccatctatcccagtgtcctggcc
tctggaccggatcgtaaaaatagcaaaacaagccagaagaccatggatgatttaaatttg
agcacctctgaggctctgcggattgaccctgttcctaacacccacccacttctcgtcttt
gtcaatcctaagagtggcgggaagcaggggcagagggtgctctggaagttccagtatata
ttaaaccctcgacaggtgttcaacctcctaaaggatggtcctgagatagggctccgatta
ttcaaggatgttcctgttagccggattttggtgtgtggtggagacggcacagtaggctgg
attctagagaccattgacaaagctaacttgccggttttgcctcctgttgctgtgttgccc
ctgggtactggaaatgatctggctcgatgcctaagatggggaggagggtatgaaggacag
aatctggcaaagatcctcaaggatttagagatgagtaaagtggtacatatggatcgatgg
tctgtggaggtgatacctcaacaaactgaagaaaaaagtgacccagtcccctttcagatc
atcaataactacttctctattggtgtggatgcctctattgctcatcgattccacatcatg
cgagagaaatatccggagaagttcaacagcagaatgaagaacaagctatggtacttcgaa
tttgccacatctgaatccatcttctcaacatgcaaaaagctggaggagtctttgacagtt
gagatctgtgggaaaccgctggatctgagcaacctgtccctagaaggcatcgcagtgcta
aacatccctagcatgcatggtggctccaacctctggggtgataccaggagaccccatggg
gatatctatgggatcaaccaggccttaggtgctacagctaaagtcatcaccgaccctgat
atcctgaaaacctgtgtaccagacctaagtgacaagagactggaagtggtcgggctggag
ggtgcaattgagatgggccaaatctataccaagctcaagaatgccggacgtcggctggcc
aagtgctctgagatcaccttccacaccacaaaaacccttcccatgcaaattgatggagaa
ccctggatgcagacgccctgtacaatcaagatcacccacaagaaccagatgcccatgctc
atgggcccacccccccgctccaccaatttctttggcttcttgagctaa

KEGG   Pongo abelii (Sumatran orangutan): 100431923
Entry
100431923         CDS       T01416                                 

Gene name
DGKZ
Definition
(RefSeq) diacylglycerol kinase zeta isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100431923 (DGKZ)
   00564 Glycerophospholipid metabolism
    100431923 (DGKZ)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100431923 (DGKZ)
   04072 Phospholipase D signaling pathway
    100431923 (DGKZ)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100431923 (DGKZ)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     100431923 (DGKZ)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 Ank_2 Ank_5 Ank_4 Ank_3 Ank
Other DBs
NCBI-GeneID: 100431923
NCBI-ProteinID: XP_024110577
LinkDB
Position
11
AA seq 970 aa
MEPRDGSPEARSSDSESASASSSGSERDAGPEPDKAPRRLNKRRFPGLRLFGHRKAITKS
GLQHLAPPPPTPGAPCSESERQIRSTVDWSESATYGEHIWFETNVSGDFCYVGEQYCVAR
MLGPSLPVLQQKSVSRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRNVREPTFVR
HHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCS
LGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRKSSKKGPEEGRWRPFIIRPTPSP
LMKPLLVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILAC
GGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEG
NVVQLDRWDLHAEPNPEAGPEDRDEGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANP
EKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVVSGARLPWVGRPEGREAEATWYMH
LNTLPARLQCDGTDLTPKIQDLKPQCVVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGY
LEVIGFTMTSLAALQVGGHGERLTQCREVVLTTSKAIPVQVDGEPCKLAASRIRIALRNQ
ATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVV
PGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLDATTASRFYRIDRAQEHLNY
VTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAA
KRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENG
ETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQM
IQREDQETAV
NT seq 2913 nt   +upstreamnt  +downstreamnt
atggagccgcgggacggtagccccgaggcccggagcagcgactccgagtcggcttccgcc
tcgtccagcggctccgagcgcgacgccggtcccgagccggacaaggcgccgcggcgactc
aacaagcggcgcttcccggggctgcggctcttcgggcacaggaaagccatcaccaagtcg
ggcctccagcacctggccccccctccgcccacccctggggccccgtgcagcgagtcagag
cggcagatccggagcacagtggactggagcgagtcagcgacatatggggagcacatctgg
ttcgagaccaacgtgtccggggacttctgctacgttggggagcagtactgtgtagccagg
atgctggggccctctcttcctgtcctgcagcagaagtccgtgtctcgaagaaagtgcgca
gcctgcaagattgtggtgcacacgccctgcatcgagcagctggagaagataaatttccgc
tgtaagccgtccttccgtgaatcaggctccaggaatgtccgcgagccaacctttgtacgg
caccactgggtacacagacgacgccaggacggcaagtgtcggcactgtgggaagggattc
cagcagaagttcaccttccacagcaaggagattgtggccatcagctgctcgtggtgcaag
caggcgtaccacagcaaggtgtcctgcttcatgctgcagcagatcgaggagccgtgctcg
ctgggggtccatgcagccgtggtcatcccgcccacctggatcctccgcgcccggaggccc
cagaatactctgaaagcaagcaagaagaagaagagggcatctttcaagaggaagtccagc
aagaaagggcctgaggagggccgctggagacccttcatcatcaggcccaccccctccccc
ctcatgaagcccctgctggtgtttgtgaaccccaagagtgggggcaaccagggtgcaaag
atcatccagtcttttctctggtatctcaatccccgacaagtcttcgacctgagccaggga
gggcccaaggaggcgctggagatgtaccgcaaagtgcacaacctgcggatcctggcgtgc
gggggcgacggcacggtgggctggatcctctccaccctggaccagctacgcctgaagccg
ccaccccctgttgccatcctgcccctgggtactggcaacgacttggcccgaaccctcaac
tggggtgggggctacaccgatgagcctgtgtccaagatcctctcccacgtggaggagggg
aacgtggtacagctggaccgctgggacctccatgccgagcccaaccccgaggcagggcct
gaggaccgagacgaaggcgccaccgaccggttgcccctggatgtcttcaacaactacttc
agcctgggctttgacgcccacgtcaccctggagttccacgagtctcgagaggccaaccca
gagaaattcaacagccgctttcggaataagatgttctacgccgggacagctttctccgac
ttcctgatgggcagctccaaggacctggccaagcacatccgagtggtggtgagtggggcc
aggctgccgtgggtgggcaggccggaagggagggaggcggaggccacctggtacatgcac
ctcaacaccctccccgcccgcctccagtgtgatggaacggacttgactcccaagatccag
gacctgaaaccccagtgtgttgttttcctgaacatccccaggtactgtgcaggcaccatg
ccctggggccaccctggggagcaccacgactttgagccccagcggcacgacgacggctac
ctcgaggtcattggcttcaccatgacgtccttggccgcgctgcaggtgggcggacacggc
gagcggctgacgcagtgtcgcgaggtggtgctcaccacatccaaggccatcccggtgcag
gtggatggcgagccctgcaagcttgcagcctcacgcatccgcatcgccctgcgcaaccag
gccaccatggtgcagaaggccaagcggcggagcgccgcccccctgcacagcgaccagcag
ccggtgccagagcagctgcgcatccaagtgagtcgcgtcagcatgcacgactatgaggcc
ctgcactacgacaaggagcagctcaaggaggcctccgtgccgctgggcactgtggtggtc
ccaggagacagtgacctagagctctgccgcgcccacatcgagagactccagcaggagccc
gatggtgctggagccaagtccccgacatgccagaaactgtcccccaagtggtgcttcctg
gacgccaccactgccagccgcttctacaggatcgaccgagcccaggagcacctcaactat
gtgactgagatcgcacaggatgagatttatatcctggaccctgagctgctgggggcatcg
gcccggcctgacctcccaacccccacttcccctctccccacctcaccctgctcacccacg
ccccggtcactgcaaggggatgctgcaccccctcaaggtgaagagctgattgaggctgct
aagaggaacgacttctgtaagctccaggagctgcaccgagctgggggcgacctcatgcac
cgagacgagcagagccgcacgctcctgcaccacgcagtcagcactggcagcaaggatgtg
gtccgctacctgctggaccacgcccctccagagatccttgatgcggtggaggaaaacggg
gagacctgtttgcaccaggcagcagccctgggccagcgcaccatctgccactacatcgtg
gaggccggggcctcgctcatgaagacagaccagcagggcgacactccccggcagcgggct
gagaaggctcaggacaccgagctggccgcctacctggagaaccggcagcactaccagatg
atccagcgggaggaccaggagacggctgtgtag

KEGG   Pongo abelii (Sumatran orangutan): 100438777
Entry
100438777         CDS       T01416                                 

Gene name
DGKH
Definition
(RefSeq) diacylglycerol kinase eta isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100438777 (DGKH)
   00564 Glycerophospholipid metabolism
    100438777 (DGKH)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100438777 (DGKH)
   04072 Phospholipase D signaling pathway
    100438777 (DGKH)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100438777 (DGKH)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     100438777 (DGKH)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 PH PH_8 C1_2 PH_11
Other DBs
NCBI-GeneID: 100438777
NCBI-ProteinID: XP_024086706
Ensembl: ENSPPYG00000005318
LinkDB
Position
13
AA seq 1164 aa
MAGAGGQHHPPGAAGGAAAGASAAVTSAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQ
IRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEAST
KNANNSFTIITPFRRLMLCAENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYA
CSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIED
EDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPICPL
GQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPA
QVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTG
NDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPGPPEAS
EEFYMTIYEDSVATHLTKILNSDEHAVVISSAKTLCETVKDFVAKVEKTYDKTLENAVVA
DAVASKCSVLNEKLEQLLQALHTDSQAAPVLPGLSPLIVEEDAVESSSEESLGESKEQLV
DDVTKPSSQKAVKPREIMLRANSLKKAVRQVIEEAGKVMDDSTVHPCEPANQSSDYDSTE
TDESKEEAKDDGAKESLTVKTAPRSPDARASYGHSQTDSVPGPAVAASKENLPVLNTRII
CPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDPDSVDGYSEKCVMNNYFGIGLD
AKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLP
SLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQH
HRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWE
DKQKCDSGKPVLRTHLYIHHAIDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQEL
AHAVNACSHALNKANPRCPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEER
VSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQK
QKTSSQPGPGDTESGPCEANSPGN
NT seq 3495 nt   +upstreamnt  +downstreamnt
atggcaggggccggaggccagcaccaccctccgggcgccgctggaggagcggccgccgga
gccagcgccgcggtcacctccgccgctgcctcggcggggccgggagaggattcgtctgac
agcgaagcggagcaagagggaccccagaaactgatccgcaaagtgtccacctcggggcag
atccggaccaagaccagtattaaagagggacagctattgaagcaaaccagttctttccaa
aggtggaaaaagcgatacttcaaacttcgaggccgcaccctttactatgcgaaggactca
aagtctctgatatttgatgaagttgacctctcagatgctagtgtagctgaagcaagcacg
aaaaatgctaacaacagcttcacgatcatcactccattcagaaggctaatgctgtgtgct
gagaacagaaaggagatggaggattggatcagctcactgaagtctgtacagaccagagaa
ccctacgaggtggcccagtttaatgtggaacatttctcagggatgcacaactggtacgcc
tgctcccacgcccgacccaccttctgtaacgtgtgcagagagagtctttctggagtcacc
tcccatggcctgtcctgcgaagtgtgtaaattcaaggctcacaaaagatgtgcagtgaga
gcaacaaataactgtaaatggactaccctggcctccatcgggaaggacattatagaagat
gaagatggcgtcgcgatgcctcaccagtggctcgagggcaacctgcctgtaagtgccaag
tgtgctgtctgcgacaaaacatgcggcagtgttctccgcctacaggattggaaatgcctt
tggtgtaagacaatggtacacactgcctgcaaagatttataccatccaatatgtccactt
ggtcaatgtaaagtatctatcatacctccaattgcactaaacagcaccgattccgatggt
ttctgtagagcaacattttcgttctgtgttagtcctctattggtttttgtcaattctaag
agtggagataatcagggagtaaagttccttcgtcgctttaaacagttgctaaatccggct
caggtgtttgatttaatgaatggaggtcctcatttaggtttaagattatttcagaagttt
gacaatttccggattcttgtttgtggaggcgatggaagtgtaggttgggttttgtcagaa
attgataagctcaacttgaataaacagtgtcagctgggagtgttgcctttgggtacagga
aatgaccttgcccgagttcttggctggggaggttcatatgacgatgacacccaacttcct
cagatcctagagaaactggaacgagccagtaccaaaatgttggacaggtggagtataatg
acatatgaactcaaattgccaccaaaagcttccctacttccaggacctccagaagcatct
gaagaattttatatgacaatttatgaagactcagttgcaacacatcttacaaaaatcctc
aattctgatgaacatgcagtggtcatatcttctgccaagacgctatgtgaaactgtaaag
gacttcgttgccaaagtagaaaagacgtatgacaaaaccttggaaaatgccgttgtagct
gatgccgtggccagtaaatgttcagtcctaaatgagaagctcgaacaactgctgcaggct
ttgcacacagattcccaggctgcgcctgttctccctggcctcagccctctcattgtggaa
gaagatgctgtggaatcgtccagtgaagagtccctgggtgaaagcaaagaacagctcgtg
gatgacgttacaaaaccttcctcccagaaagctgtcaaaccaagggaaatcatgttgcgg
gcaaatagtttaaagaaagcagtgaggcaagtcattgaggaagccggaaaagttatggat
gactcgacagttcacccctgtgaaccagctaatcagtcctctgattatgacagcacagaa
acagatgaatctaaggaggaagctaaagatgatggtgccaaagaatcattaactgttaaa
actgcacctcggtctccagatgcccgggcaagttatggccattcccaaactgattctgtc
cctggtccagctgtggcagccagcaaagaaaacctccctgtgctcaataccagaataatc
tgcccaggtttaagagcaggactggctgcctcaattgctgggagttcgattatcaacaaa
atgttactggcaaacattgatccttttggtgccacgccgtttattgatccagatccagat
tccgtagatggatattcagaaaaatgtgtcatgaacaattactttgggattggattagat
gcaaaaatttcattagaatttaataataaaagagaggagcaccctgaaaaatgcaggagc
cgaactaaaaacttgatgtggtatggagtccttggaacccgggagttattacagagatcg
tacaagaatttagaacaaagggttcaacttgagtgcgatgggcagtatattcctcttccc
agcttgcaaggcatagccgtgttgaacattcccagctatgctggaggcactaacttttgg
ggtggaactaaagaggatgatatatttgctgcaccatcctttgatgacaagatcctggaa
gttgtagcaatatttgatagcatgcaaatggcagtttcaagggtcattaaactgcagcat
catcgaatagcccagtgccgtacggtgaaaatcactatatttggtgatgaaggagtccca
gtgcaagtggatggtgaagcatgggttcagcctccagggattatcaaaattgtgcacaaa
aacagagcacaaatgctaacaagggacagagcctttgagagcactctgaaatcttgggaa
gataagcagaagtgtgattctggtaaaccagttctccgaacccatttgtacatccatcac
gccattgacttggcaacagaagaggtgtcgcagatgcagctgtgctcccaggctgcagag
gagctcattactaggatctgtgacgcagccacaattcactgtcttttggagcaagaactg
gcccatgctgtgaatgcctgctcccatgccctgaataaagccaacccaaggtgcccggag
agtcttacaagagacactgccactgaaatagccatcaatgtgaaggcgctgtataatgaa
acagaatctttgctagttggcagggttcctttgcagctggaatcgccacatgaagagcgg
gtatccaatgccttacactctgtggaggtggaattacagaaactcacagagattccttgg
ctttattatatcttacacccaaatgaggatgaggaacctcctatggattgcaccaaaaga
aacaacagaagcaccgtatttcgaatagtgccaaagtttaaaaaggaaaaggttcagaag
cagaagacaagttcacagcctggacctggggataccgaaagtgggccatgtgaagcgaat
tctccagggaattaa

KEGG   Pongo abelii (Sumatran orangutan): 100439722
Entry
100439722         CDS       T01416                                 

Gene name
DGKB
Definition
(RefSeq) diacylglycerol kinase beta isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100439722 (DGKB)
   00564 Glycerophospholipid metabolism
    100439722 (DGKB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100439722 (DGKB)
   04072 Phospholipase D signaling pathway
    100439722 (DGKB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100439722 (DGKB)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     100439722 (DGKB)
SSDB
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 SPARC_Ca_bdg C1_2
Other DBs
NCBI-GeneID: 100439722
NCBI-ProteinID: XP_024105496
Ensembl: ENSPPYG00000017771
LinkDB
Position
7
AA seq 804 aa
MTNQEKWAHLSPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKYNPEGKQDILNQTIDF
EGFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPMVKSKPALLSGGLRMNKGAITPPR
TTSPANTCSPEVIHLKDIVCYLSLLERGRPEDKLEFMFRLYDTDGNGFLDSSELENIIGQ
MMHVAEYLEWDVTELNPILHEMMEEIDYDHDGTVSLEEWIQGGMTTIPLLVLLGLENNVK
DDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVK
SKRNTDVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDC
GPLKDHILPPTTICPVVLQTLPTSGVSVPEERQSTVKKEKSGSQQPNKLIDKNKMQRANS
VTVDGQGLQITPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGL
NFFRDVPDFRVLACGGDGTVGWVLDCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYE
GENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDASIAHRFH
IMREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIA
ILNIPSMHGGSNLWGESKKRRSHRRIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGL
EGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKITHKNQAPM
LMGPPPKTGLFCSLVKRTRNRSKE
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgacaaaccaggaaaaatgggcccacctcagcccttcggaattttcccaacttcagaaa
tatgctgagtattctacaaagaaattaaaggatgttcttgaagaattccatggtaatggt
gtgcttgcaaagtataatcctgaagggaaacaagacattcttaaccaaacaatagatttt
gaaggtttcaaactattcatgaagacattcctggaagccgagcttcctgatgatttcact
gcacaccttttcatgtcatttagcaacaagtttcctcattctagtccaatggtaaaaagt
aagcctgctctcctatcaggcggtctgagaatgaataaaggtgccatcacccctccccgg
actacttctcctgcaaacacgtgttccccagaagtaatccacctgaaggacattgtctgt
tacctgtctctgcttgaaagaggaagacctgaggataagcttgagtttatgtttcgcctt
tatgacacggatgggaatggcttcctggacagctcggagctggaaaatatcatcggtcag
atgatgcatgttgcagaataccttgagtgggatgtcactgaacttaatccaatcctccat
gaaatgatggaagaaattgactatgatcatgatggaaccgtgtctctggaggaatggatt
caaggaggaatgacaacgattccacttcttgtgctcctgggcttagaaaataacgtgaag
gatgatggacagcacgtgtggcgactgaagcactttaacaaacctgcctattgcaacctt
tgcctgaacatgctgattggcgtggggaagcagggcctctgctgttccttctgcaagtac
acagtccatgagcgctgtgtggctcgagcacctccctcttgcatcaagacctatgtgaag
tccaaaaggaacactgatgtcatgcaccattactgggttgaaggtaactgcccaaccaag
tgtgataagtgccacaaaacagttaaatgttaccagggcctgacaggactgcattgtgtt
tggtgtcagatcacactgcataataaatgtgcttctcatctaaaacctgaatgtgactgt
ggacctttgaaggaccatattttaccacccacaacaatctgtccggtggtactgcagact
ctgcccacttcaggagtttcagttcctgaggaaagacaatcaacagtgaaaaaggaaaag
agtggttcccagcagccaaacaaattgatcgacaagaataaaatgcaaagagccaactct
gttactgtagatggacaaggcctgcagatcactcctgtgcctggtactcacccactttta
gtttttgtgaaccccaaaagtggtggaaaacaaggagaacgaatttacagaaaattccag
tatctactaaatcctcgtcaggtttacagtctttctggaaatggaccaatgccagggtta
aactttttccgtgatgttcctgacttcagagtgttagcctgtggtggagatggaaccgtg
ggctgggttttggattgcatagaaaaggccaatgtaggcaagcatcctccagttgcaatt
ctgcctcttgggactggcaatgatctagcaagatgcctgcgatggggaggaggttatgaa
ggtgagaatctgatgaaaattctaaaagacattgaaaacagcacagaaatcatgttggac
aggtggaagtttgaagtcatacctaatgacaaagatgagaagggagacccagtgccttac
agtatcatcaataattacttttccattggcgtggatgcctccattgcacacagattccac
atcatgagagaaaaacacccagagaaattcaacagtagaatgaagaacaaattttggtat
tttgagtttggcacatctgaaactttctcagccacctgcaagaagctacatgaatctgta
gaaatagaatgtgatggagtacagatagatttaataaacatctctctggaaggaattgct
attttgaatataccaagcatgcatggaggatccaatctttggggagagtctaagaaaaga
cgaagccatcgacgaatagagaaaaaagggtctgacaaaaggaccaccgtcacagatgcc
aaagagttgaagtttgcaagtcaagatctcagtgaccagctgctggaggtggtcggcttg
gaaggagccatggagatggggcaaatatacacaggcctgaaaagtgctggccggcggctg
gctcaatgctcctgcgtggtcatcaggacgagcaagtctctgccaatgcaaattgatggg
gagccatggatgcagaccccatgcactataaaaattacacacaagaaccaagccccaatg
ctgatgggccctcctccaaaaaccggtttattctgctccctcgtcaaaaggacaagaaac
cgaagcaaggaataa

KEGG   Pongo abelii (Sumatran orangutan): 100439951
Entry
100439951         CDS       T01416                                 

Gene name
DGKK
Definition
(RefSeq) diacylglycerol kinase kappa isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100439951 (DGKK)
   00564 Glycerophospholipid metabolism
    100439951 (DGKK)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100439951 (DGKK)
   04072 Phospholipase D signaling pathway
    100439951 (DGKK)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100439951 (DGKK)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     100439951 (DGKK)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat PH C1_1 Prok-RING_1 PH_3 VHL C1_2
Other DBs
NCBI-GeneID: 100439951
NCBI-ProteinID: XP_024096174
Ensembl: ENSPPYG00000020353
LinkDB
Position
X
AA seq 1257 aa
MDRGAAAAQGTAPPQDGEQPAESPEPPPPWPPPPPPPAPPPAPPLLSEASPEPIPEPCPE
LAPGPCPEATSEPATELYTEPTPEPATEPASEPAPEPATEPAPEPATEPAPEPAPEPALE
SAPEPAPELTPEVAPEPAPEPTPEPVTELAPEFCPEAAPESRPSPAPCLLQCPVDTRERG
LKTSPSPSPSPRTPMSWSRIKKILKEGPMLKNCNSFKRWKLRYFLVQGQKLYFAHHPAFA
HFETIDLSQATVAESSCRNLCHSFCVITPQRKITLAAPNRKDMEEWINIIKTVQQGEIYK
IPAAENNPFLVGMHCWYSSYSHRTQHCNVCRESIPALSRDAIICEVCKVKSHRLCALRAS
KDCKWNTLSVTDDLLLPADEVNMPHQWVEGNMPVSSQCAVCHESCGSYQRLQDFRCLWCN
STVHDDCRRRFSKECCFGSHRSSVIPPTALSDPKGDGQLVVSSDFWNLDWSSACSCPLLI
FINSKSGDHQGIVFLRKFKQYLNPSQVFDLLKGGPEAGLSMFKNFARFRILVCGGDGSVS
WVLSLIDAFGLHEKCQLAVIPLGTGNDLARVLGWGAFWNKSKSPLDILNRVEQASVRTLD
RWSVMIRETPRQTPLLKGQVEMDVPRFEAAAIRHLESAATELNKILKAKYPTEMIIATRF
LCSAVEDFVVDIVKAWGQIKQNNTAIVSVILKSDLMYDKLSVLIDVLAEEAAATSAEKSA
TEYADSSKADRKPFVPQIDHIAKCKLELATKAQNLQKSLKLIIFQVEQVLDEESRQTISV
KNFSSTFFLEDDPEDINQTSPRRRSHRGTLSSISSLKSEDLDNLNLDHLHFTPESIRFKE
KCVMNNYFGIGLDAKISLDFNTRRDEHPGQYNSRLKNKMWYGLLGTRELLQRSYRKLEER
VHLECDGETISLPNLQGIVVLNITSYAGGINFWGSNTATTEYEAPAIDDGKLEVVAIFGS
VQMAMSRIINLHHHRIAQCHEVMITIDGEEGIPVQVDGEAWIQRPGLIKIRYKNAAQMLT
RDRDFENSMKMWEYKHTEIQAAPQPQLDSQDSQESLSDEEYAQMQHLARLAENLISKLND
LSKIHQHVSVLMDSVNASANILNDIFYGQDSGNEMGAASCIPIETLSRNDAVDVTFSLKG
LYDDTTAFLDEKLLRSAEDETSLQSTLEAMNKEFKKLSEIDWMNLIFVPEEKSSATDSRS
LRLKIKFPKLGKKKLEEELKPKSGQSVQSFIGSLWHRRHREDKAEGDDPLTPSRSQL
NT seq 3774 nt   +upstreamnt  +downstreamnt
atggaccgcggagctgccgcggcccagggcactgccccgcctcaggatggagagcagccc
gctgagtctccagagcctccgccgccttggccgccgccgccaccaccaccggctccgccg
ccggctccgccgctgctctccgaggcttcgccagaacccataccagagccctgtccagag
cttgctccaggaccctgtccagaggcgacctcagaaccagccacagaactgtacacagaa
ccgaccccagaaccagccacagagccggcctcagaaccggccccagaacctgccacagag
ccggccccagaacctgccacagagccggccccagaaccggccccagaacctgccctagag
tcggccccagagccggccccagagctgactccagaagttgccccagagccggccccagag
ccgaccccagaacctgtgacagagctggccccagagttctgccctgaggcggctccagag
tcccgtccaagtccagcaccatgtctattgcaatgtccggtggacactcgagagagaggt
ctaaagacctcgccatcgccatcgccatcacccagaacgccaatgtcgtggtccagaata
aagaaaatattgaaggaaggacctatgctgaagaactgtaactccttcaagagatggaag
cttagatattttctggttcaaggacagaagctctactttgcacaccatcccgcgtttgca
cactttgaaacgattgatctgtctcaagccactgtggcagaaagcagctgcagaaacctt
tgccacagtttttgtgttatcacaccacaacgaaaaatcactctggctgcacccaaccgg
aaagacatggaagaatggattaacatcataaaaaccgtccaacagggagaaatttataag
atacctgcagcagaaaacaacccttttcttgttggaatgcactgttggtactccagctac
agccaccggacccagcactgcaatgtttgtcgagagagcattcctgccttatctagagat
gccatcatctgtgaagtgtgcaaagtgaaatctcacagattatgtgctttgagagcaagc
aaagactgcaagtggaatacattgtctgtcactgatgacctcctcctgcctgcagatgaa
gtaaacatgccccatcaatgggtagaaggaaacatgcctgtcagctctcagtgtgcagta
tgtcatgagagctgtggcagttatcaaagacttcaagacttccgctgcctgtggtgtaat
tctacggtgcatgatgactgtaggagacggttttccaaggaatgttgcttcggaagccat
cgctcatcagtcattcctcccactgctctaagcgaccccaaaggcgatggccaattagta
gtatcttcggacttctggaatcttgattggtcatcagcctgttcatgtcccttgctcatc
ttcatcaactccaaaagtggcgatcatcaggggattgtcttcctccgaaaattcaagcaa
taccttaacccatctcaagtgttcgacctgttgaagggtggacctgaagcagggctgtct
atgttcaagaactttgctcgctttcgcattctggtttgtggtggagatggcagcgtgagc
tgggtcttatctctgattgatgcctttggattacatgaaaagtgtcagctggcagtcatc
ccacttggaaccggcaatgatctggctcgtgtcctaggctggggtgcattctggaacaaa
agcaagtcacctctggacatcctcaacagagtggagcaggctagtgtgaggaccctagac
agatggagtgtgatgattcgtgagactcccagacaaaccccgctgctaaaaggacaggtt
gaaatggatgtaccacgatttgaggctgctgccatccgacacttagaatctgcagccacc
gagttgaacaaaatcctgaaggccaagtaccccacagagatgatcatcgcaaccagattc
ttgtgttcagccgtggaagattttgtggttgatattgtaaaggcctggggtcagataaaa
cagaacaatacagcaatagtgtctgtgattctgaaaagtgacttaatgtatgataagctc
agtgtcctgatcgatgtcctggctgaggaggcagcagctacttctgctgagaaaagtgct
acagaatatgcagacagcagcaaggcagataggaagcccttcgttcctcaaatagaccac
atagccaagtgcaagttggagctggctacaaaggcccagaatctccagaaatccttgaaa
ctcatcatattccaagttgaacaagttctggatgaggaaagcagacagacaatatctgtt
aagaactttagttcaactttcttcctggaagatgacccagaagatattaaccagacaagc
ccacgacgccgttctcatcgtggcactttgtcttctatatcttctctcaaaagtgaggac
ctagacaatcttaacttggatcacttacattttacacctgaatctatacgcttcaaagaa
aaatgtgtcatgaacaactacttcggaattggactggatgctaaaatttctctggacttc
aacaccagaagagatgaacacccagggcaatacaatagccgccttaagaacaagatgtgg
tatggccttctgggaaccagggaacttttgcagcgctcttacaggaaactggaagaacga
gtgcatttggagtgtgatggagaaaccatctccttgccaaacctgcaaggcattgtagtg
ctcaacattaccagctatgccggaggtatcaacttctggggaagcaacacagcaaccacg
gaatatgaggctcctgcaatcgatgatgggaaactggaggtggtggcaatctttggttct
gtgcagatggcaatgtcccgtatcatcaacctgcatcatcatcgcattgcccagtgccat
gaggtgatgataaccattgatggtgaagaaggtattccagtgcaggtggatggggaggcc
tggattcagagaccaggccttatcaagattagatacaagaacgctgcccagatgctgaca
agagatcgggactttgagaactcaatgaaaatgtgggaatacaagcatactgaaattcaa
gctgcccctcaaccccagctggactcccaggactctcaagagagcctctctgatgaggag
tatgcccagatgcagcacttagctcggcttgcagaaaacctcatcagcaaacttaatgac
ctgagcaagatccaccagcatgtgtctgtcctcatggattctgtgaatgccagcgctaac
atcctgaatgatatattttacggccaagacagtggcaatgagatgggtgcagcttcctgt
attcccattgaaactctaagcagaaatgatgctgtagatgttacatttagtcttaaaggg
ctctacgatgacaccacagctttcctggatgaaaagctgctgagaagtgctgaggatgag
acctcactacaaagcaccctggaagctatgaataaggagttcaaaaagctatctgagatt
gactggatgaatctgatctttgttccagaggaaaaatcttcggccactgacagtagaagc
ctcaggctgaaaattaagttccccaaattgggaaagaaaaagctagaagaggaactcaag
cctaaatcaggccagagtgtccagagttttattggcagtttatggcaccgcagacatcgt
gaagataaagcagagggtgatgatcctctaacaccatcaagatctcaactgtag

KEGG   Pongo abelii (Sumatran orangutan): 100440522
Entry
100440522         CDS       T01416                                 

Gene name
DGKE
Definition
(RefSeq) diacylglycerol kinase epsilon isoform X2
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100440522 (DGKE)
   00564 Glycerophospholipid metabolism
    100440522 (DGKE)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100440522 (DGKE)
   04072 Phospholipase D signaling pathway
    100440522 (DGKE)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100440522 (DGKE)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     100440522 (DGKE)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1
Other DBs
NCBI-GeneID: 100440522
NCBI-ProteinID: XP_009249862
LinkDB
Position
17
AA seq 529 aa
MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKH
GWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCVRKADKRFQCKEIMLKNDTKVL
DAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFG
EFKNLIIPPSYLTSINQMRKDKKTDYEVLASKLGKQWTPLIILANSRSGTNMGEGLLGEF
RILLNPVQVFDVTKTPPIKALQLCTLLPYYSARVLVCGGDGTVGWVLDAVDDMKIKGQEK
YIPQVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYY
NLRKPKAVYLFYGTKDCLVQECKDLNKKVELELDGERVALPSLEGIIVLNIGYWGGGCRL
WEGMGDETYPLARHDDGLLEVVGVYGSFHCAQIQVKLANPFRIGQAHTVRLILKCSMMPM
QVDGEPWAQGPCTVTITHKTHAMMLYFSGEQTDDDISSTSDQEDIKETE
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggaagcggagaggcggccggcgccgggctcgccctccgagggcctgtttgcggacggg
cacctgatcttgtggacgctgtgctcggtcctgctgccggtgttcatcaccttctggtgt
agccttcagcggtcgcgccggcagctgcaccgcagggacatcttccgcaagagcaagcac
gggtggcgcgacacggacctgttcagccagcctacctactgctgcgtgtgcgcgcagcac
attctgcagggcgccttctgcgactgctgcgggctccgcgtggacgagggctgcgtcagg
aaggccgacaagcgcttccagtgcaaggagattatgctcaagaatgacaccaaggtcctg
gacgccatgccccaccactggatccggggcaacgtgcccttgtgcagttactgtatggtt
tgcaagcagcagtgtggctgtcaacccaagctttgcgattacaggtgcatttggtgccag
aaaacagtacatgatgagtgtatgaaaaatagtttaaagaatgaaaaatgtgattttgga
gaattcaaaaacctaatcattccaccaagttatttaacctccattaatcagatgcgtaaa
gacaaaaaaacagattatgaagtgctagcctctaagcttggaaagcaatggaccccatta
ataatcctggccaactctcgtagtggaactaatatgggagaaggactgttgggagaattt
aggatcttgttgaatccagtccaggtttttgatgtaactaaaactcctcctatcaaagcc
ctacaactctgtactcttcttccatattattcagctcgagtacttgtttgtggaggggat
gggactgtagggtgggtcctggatgcagttgatgacatgaagattaagggacaagaaaag
tacattccacaagttgcagttttgcctctgggaacaggcaacgatctatccaatacattg
ggttggggtacaggttatgctggagaaattccagttgcacaggttttgcgaaatgtaatg
gaagcagatggaattaaactggatcgatggaaagttcaagtaacaaataaaggatactac
aacttaagaaaacccaaggcggtttacttattctatggaaccaaagattgtttagtgcag
gaatgtaaagatttgaataaaaaagttgagctagaactggatggtgagcgagtagcactg
cccagcttggaaggtattatagttctgaacatcggatactggggcggtggctgcagacta
tgggaagggatgggggacgagacttaccctctagccaggcatgacgatggtctactggaa
gtcgttggagtatatgggtctttccactgtgctcagattcaagtaaaactggctaatccg
tttcgaataggacaggcacatacagtgaggctgattttgaagtgctccatgatgccaatg
caggtggatggggagccttgggcccaagggccctgcactgtcaccataactcacaagaca
catgcaatgatgttatatttctctggagaacaaacagatgatgacatctctagtacttcg
gatcaagaagatataaaggagactgaatag

KEGG   Pongo abelii (Sumatran orangutan): 100446422
Entry
100446422         CDS       T01416                                 

Gene name
DGKD
Definition
(RefSeq) diacylglycerol kinase delta isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100446422 (DGKD)
   00564 Glycerophospholipid metabolism
    100446422 (DGKD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100446422 (DGKD)
   04072 Phospholipase D signaling pathway
    100446422 (DGKD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100446422 (DGKD)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     100446422 (DGKD)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat SAM_2 C1_1 SAM_1 PH PH_3 PH_8 C1_2 PH_11 SAM_3 SAM_PNT SBE2
Other DBs
NCBI-GeneID: 100446422
NCBI-ProteinID: XP_024099387
LinkDB
Position
2B
AA seq 1214 aa
MAAAAGAPPPGPPQPSPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQKTIIKEGML
TKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNSFTVITP
CRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHFSGMHNWYACSHARPTYCNVC
REALSGVTSHGLSCEVCKFKAHKRCAVRATSNCKWTTLASIGKDIIEDADGIAMPHQWLE
GNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLLTKCPLGLCKVSVIPPTA
LNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPH
LGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGS
ACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQASSSTVTEDLSEDSEVQQILFY
EDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTESSEESEVMAKKCS
VLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDAPGSVCGSTGDRLVASACPARP
QIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQEGFVLGLSESEETMDHRVC
PPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSASLPPQPGSRDGLLALNTKIL
YPNVRAGMSGSLPGGSVISRLLINADPFNAEPETLEYYTEKCVMNNYFGIGLDAKISLDF
NNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLECDGRPIPLPSLQGIAV
LNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIRLQHHRIAQCR
TVKISILGDEGVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRAFESTLKSWEDKQKCEL
PRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSM
DRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDPPQKEQLGSALAEMD
RQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHSSLGA
PVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVTKVGHMKRILC
GIKELSRSAPAAEA
NT seq 3645 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgggcgcccctccgccgggtccgccgcaaccgtctccgccgccgccg
cccgaggagtcgtccgacagcgagcccgaggcggagcccggctccccacagaagctcatc
cgcaaggtgtccacgtcgggtcagatccgacagaagaccatcatcaaagaggggatgctg
accaaacagaacaattcattccagcgatcaaaaaggagatactttaagcttcgagggcga
acgctttactatgccaaaacggcaaagtcaatcatatttgatgaggtggatctgacagat
gccagcgtggctgaatccagtaccaaaaacgtcaacaacagttttacggtcataactcca
tgcaggaagctcatcttgtgtgctgataacagaaaagaaatggaagattggattgcagca
ttaaagactgtgcagaacagggagcactttgagcccacccagtacagcatggaccacttc
tcagggatgcacaattggtacgcctgttcccatgcgaggccgacctactgcaatgtgtgc
cgtgaggctctgtctggggtcacgtcgcatgggctgtcctgcgaggtgtgcaaatttaag
gcccacaagcgctgtgctgtgcgtgcaaccagtaactgcaagtggaccacactggcctcg
atcgggaaggacatcattgaagatgcagatgggatcgcaatgccccaccagtggttggaa
ggaaacctacctgtgagcgccaagtgcactgtgtgcgacaagacctgtggcagtgtgctg
cgcctgcaggactggcgctgcctctggtgcaaggccatggttcacacatcatgtaaagaa
tccttgctgacgaagtgcccgcttggcctgtgcaaagtgtcagtcatcccacccacggct
ctcaacagcattgactctgatgggttctggaaggccagctgtcctccgtcttgcacaagc
ccactgttggtcttcgtcaattcaaaaagtggggacaaccagggtgtgaagttcctcaga
agattcaaacagctgctaaaccccgcccaggtcttcgacctcatgaacggaggcccacac
ctcggcttacggttattccagaagtttgacacattccggattctggtttgtggcggggat
ggaagtgttggctgggtcctctccgaaatcgacagcctcaaccttcataaacagtgtcag
ctgggagtgctgccactcggcacagggaacgacttggcccgagtgctgggctggggctca
gcctgcgatgacgacacccagctcccccagatcttggagaagttggagagagccagcact
aagatgctggacaggtggagcgtcatggcatacgaggccaagctcccccggcaggcctcc
tcctctaccgtcaccgaagacctcagcgaggattccgaggtgcagcagattctcttctat
gaagactcagttgcagcccacctttctaaaatcctcacctcggaccagcactcggtggtc
atctcctcggccaaagtgctctgtgagacggtgaaggactttgtggcacgggtggggaaa
gcctatgagaagacgaccgagagctcggaggagtcagaggtcatggccaagaagtgctct
gtcctgaaagagaagctggattcccttctcaagaccttggatgatgagtcccaggcctcg
tcctctctgcccaacccgccccccaccattgccgaggaggctgaagatggagatgcgcca
ggcagcgtctgcggctccaccggggaccgcttggtggcatcagcttgcccggcccggccg
caaatattccggcctcgagaacagctcatgctgagagccaacagcctgaagaaagcgatt
cgtcagatcatagaacacacagaaaaagctgtggatgagcagaatgcccagacccaggag
caggagggcttcgtcctgggcctctctgagtcagaggagacgatggaccacagagtgtgc
ccaccactgtcccacagcgagagcttcggggtccccaaggggaggagccagcgcaaagtg
tcgaaatctccgtgtgaaaagctgatcagcaaaggaagtctgtccctgggcagttctgct
tcccttccaccccagccgggaagccgggacggtctgcttgcgctcaacaccaagatcctg
tacccaaatgtccgggctggaatgtctggttccttgcctggtggctcagtcatcagtcgc
ctgttaattaatgctgatcccttcaacgctgaaccagaaaccctagagtattacacggag
aaatgtgtcatgaacaactattttggcattggcctggatgcgaagatctccctggacttt
aacaacaagcgcgatgagcacccagagaagtgcaggagccgaaccaagaacatgatgtgg
tatggagttcttggaaccaaagagttgctgcacagaacctacaagaacctggagcaaaag
gtcttgctggagtgtgacgggcgacccatcccactccccagtcttcagggaattgctgtc
cttaacattcccagctatgccggaggaaccaacttctggggggggaccaaagaagacgat
actttcgcagctccatcattcgatgacaagattctggaggtggtcgccgtgttcggcagc
atgcagatggccgtctctcgagtcatcaggctgcagcatcatcggattgcccagtgtcgc
acggtgaagatctccatccttggggatgagggcgtgcctgtgcaggtggacggagaggcc
tgggtccagccgccagggtacattcggattgtccacaagaaccgggcgcagacactgacc
agagacagggcatttgagagcaccctgaagtcctgggaagacaagcagaagtgcgagctg
ccccgccctccatcctgttccctgcacccggagatgctgtctgaggaggaggccacccag
atggaccagtttgggcaggcggcaggggtcctcattcacagtatccgagaaatagctcag
tctcaccgggacatggagcaggaactggcccacgccgtcaatgccagctccaagtccatg
gaccgtgtgtatggcaagcccagaaccacagaggggctcaactgcagcttcgtcctggaa
atggtgaataacttcagagctctgcgcagtgagacggagctgctgctgtctgggaagatg
gccctgcagctggatccgcctcagaaggagcagctggggagtgctcttgccgagatggac
cgacagctcaggaggctggcggacaccccgtggctctgccagtccgcagagcccggcgac
gaagagagtgtgatgctggatcttgccaagcgcagtcgcagtggtaaattccgcctcgtg
accaagtttaaaaaggagaaaaacaacaagaacaaagaagctcacagtagcctgggagcc
ccggttcacctctgggggacagaggaggttgctgcctggctggagcacctcagtctctgt
gagtataaggacatcttcacgcggcacgacatccggggctctgagctcctgcacctggag
cggagggacctcaaggacctgggcgtgaccaaggtgggccacatgaagaggatcctgtgt
ggcatcaaggagctgagccgcagcgcccccgccgccgaggcctag

KEGG   Pongo abelii (Sumatran orangutan): 100452590
Entry
100452590         CDS       T01416                                 

Gene name
DGKI
Definition
(RefSeq) LOW QUALITY PROTEIN: diacylglycerol kinase iota
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100452590 (DGKI)
   00564 Glycerophospholipid metabolism
    100452590 (DGKI)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100452590 (DGKI)
   04072 Phospholipase D signaling pathway
    100452590 (DGKI)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100452590 (DGKI)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     100452590 (DGKI)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 Ank_2 Ank_3 Ank_5 Ank_4 Ank
Other DBs
NCBI-GeneID: 100452590
NCBI-ProteinID: XP_024105926
LinkDB
Position
7
AA seq 1066 aa
MDAAGRGCHLLPLPAARGPARAPAAAAAASAASPPGPCSGAAXAPSAAAGAGAMNPSSSA
GEEKGATGGSSSGGSGAGSCCLGAEGGADARGAGAAAAAGAAALDEPAAAGQKEKDEALE
EKLRNLTFRKQVSYRKAISRAGLQHLAPAHPLSLPVANGPAKEPRATLDWSENAVNGEHL
WLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREG
GSRSPRENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTC
FMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQEN
KGRPFVIKPISSPLMKPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALE
LYRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTD
EPVSKILCQVEDGTIVQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAHV
TLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQE
LKFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGE
RLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDPQS
VPDRLRIRVNKISLQDYEGFHYDKEKLREASISDWLRTIAGELVQSFGAIPLGILVVRGD
CDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHL
HFVMEISQDEIFILDPDMVVSQPAGTPPGMPDLVVEQASGISDWWNPALRKRMLSDSGLG
MIAPYYEDSDLKDLSHSRVLQSPVSSEDHAILQAVIAGDLMKLIESYKNGGSLLIQGPDH
CSLLHYAAKTGNGEIVKYILDHGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGA
SLRKTDSKGKTPQERAQQAGDPDLAAYLESRQNYKVIGHEDLETAV
NT seq 3201 nt   +upstreamnt  +downstreamnt
atggatgctgcgggaaggggctgccatttgctgcccctgccagcggcgcgcggacctgcc
cgcgctcctgcagccgccgccgccgccagcgccgccagcccgcccggcccctgcagcggc
gccgcctgagctccctccgcggccgccggagcgggcgccatgaaccccagctcctcggcg
ggagaggagaaaggggcgacgggcggcagcagcagcggcggaagcggcgccgggagctgc
tgcctgggcgccgagggcggcgcggacgcgcggggcgcaggggcagccgcggcggcgggg
gccgctgccctggacgagcccgcggccgccggccagaaagagaaggacgaagcgctggag
gagaagctgaggaacttaactttccggaagcaggtctcgtacaggaaagcaatctcccgg
gcaggcctccagcatctggctcctgcacatcccctcagccttcctgtggcaaatggtcca
gccaaggagcccagagcaactttggactggagtgagaatgccgtgaatggagaacacctg
tggctggagaccaacgtctcgggagatctctgctaccttggagaggagaactgccaagtc
agatttgcaaaatcagctctcaggaggaagtgtgcagtctgtaaaatcgtcgtccacacc
gcctgcatcgagcagctagaaaagattaatttcagatgtaaaccaacatttcgagaagga
ggctcaaggtcaccaagagaaaattttgtacgtcatcactgggtgcacaggcgtcggcag
gaggggaaatgtaagcagtgtggtaagggcttccagcaaaagttctccttccacagtaaa
gagattgtggctatcagctgttcctggtgcaagcaggcgtttcacaataaggtgacctgc
ttcatgctgcatcacattgaagaaccctgctccctgggggctcatgctgctgttattgtc
ccgcccacttggatcattaaggtgaagaaacctcagaactccctgaaggcttcaaatcgg
aagaagaagagaacaagctttaaaagaaaagccagtaaaagagggatggaacaggaaaac
aaaggtcgtccttttgtgataaaacccatctcttctcctctcatgaaacccttgcttgta
tttgtgaatcccaagagtggaggcaaccagggaaccaaagtcctgcagatgttcatgtgg
tacctgaatccacggcaagtgtttgatctttctcaggaagggccaaaagatgcgcttgaa
ttgtataggaaagtaccaaatctgcgaattctggcctgtggtggggatggaacggtgggc
tggatcctttccatcctggatgaactgcagctgagccctcagcctcctgtgggggtcctt
cctctggggactgggaatgacctggctcgaactctcaactggggagggggctacactgat
gaacctgtttctaagatcctgtgtcaagtggaagatgggacaattgtacagctagatcgc
tggaacctccatgtggaaagaaaccccgacttgcctccagaagaacttgaagatggcgta
tgtaagctccctctgaatgttttcaataactacttcagccttggatttgatgctcatgtc
acactggagttccatgaatccagagaagcaaatccagagaaattcaacagtcgttttcga
aataaaatgttctatgcaggggcagctttttctgacttcctacagagaagttctagagat
ctatccaaacatgttaaagttgtttgtgatggaacagatctcaccccaaagattcaggaa
ctgaagttccagtgtatagtatttttaaatatacccagatattgtgctggcacaatgccc
tggggaaacccaggagatcaccacgatttcgaacctcaacgtcatgatgatggttatatt
gaagtcattggatttaccatggcctctttggcagccctgcaagttgggggccacggagag
aggctacaccagtgtcgagaagtcatgcttctaacttacaaatccattcccatgcaagtg
gatggggagccctgtaggttggccccagctatgattcggatctccctgaggaatcaggcc
aacatggtacagaagagcaagaggagaacatccatgcctttactcaatgatccccagtct
gtcccagatcgtctgaggatccgggtgaacaaaatcagtttacaagactatgaaggattc
cactatgacaaggagaaactccgagaagcttctatttcagactggttaagaaccattgct
ggggaactagtgcagtcctttggagcgatacctctgggtattctagttgtgcgtggagac
tgtgatttggagacttgccgtatgtacatagaccgcctacaggaggacctacagtcggtt
tcttctggctcccagagagttcattaccaggaccatgaaacctccttccccagggctctc
tcagcacagaggctctctcctcggtggtgcttcctagatgacagatctcaggaacatttg
cactttgtgatggagatttcccaagatgagatttttattctggacccagatatggtggtg
tcacagccggcagggacacctccgggcatgcctgacctggtggtggagcaagcctcgggg
atctcagactggtggaatcctgccctgcggaaacgcatgctgagtgacagtgggctgggg
atgatagctccctattatgaggactcagatctgaaagatctcagccactcccgcgtgcta
cagtcaccagtctcttcagaagatcatgcaattttgcaggcagtgatagctggcgatctt
atgaagctaatagaaagctataaaaatggaggcagtctgctaattcagggaccagaccac
tgttcactccttcactacgcagctaaaaccggcaacggggagattgtgaaatatatcctt
gaccacggaccttccgagttattggatatggcagacagtgaaacgggtgagactgcactg
cacaaggctgcctgccagcggaaccgggctgtgtgccagcttctggtggatgcaggagca
tctctgagaaagacggactccaagggtaagacacctcaagaaagagcacagcaggctggg
gacccagacttggctgcttacctagaaagccgtcagaactataaggtcattggccatgag
gacctggaaactgctgtttga

KEGG   Pongo abelii (Sumatran orangutan): 100457783
Entry
100457783         CDS       T01416                                 

Gene name
DGKQ
Definition
(RefSeq) diacylglycerol kinase theta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100457783 (DGKQ)
   00564 Glycerophospholipid metabolism
    100457783 (DGKQ)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100457783 (DGKQ)
   04072 Phospholipase D signaling pathway
    100457783 (DGKQ)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100457783 (DGKQ)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     100457783 (DGKQ)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 RA C1_2
Other DBs
NCBI-GeneID: 100457783
NCBI-ProteinID: XP_024101479
LinkDB
Position
4
AA seq 940 aa
MAAAAEPGARAWLGDGSPRPGSPACSPVLGAGGRARPGPGPGPERAGARAPGPAAAPGHS
FRKVTLTKPTFCHLCSDFIWGLAGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPVAH
CFGPRGLHKRKFCAVCRKVLEAPALHCEVCELHLHPDCVPFACSDCRQCHQDGHQDHDTH
HHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSVCSAALAPECGFGRLRSL
VLPPACVRLLPGGFSKMQSFRIVEAAEPGEGGDGADGSAAVGPGRETQATPESGKQTLKI
FDGDDAVRRSQFRLITVSRLAGAEEVLETALRAHHIPEDPGHLELCRLPPSSQACDAWAR
GKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEVLKIYPGWLKVGVAYVSVRVTPKST
ARSVVLEVLPLLGRQAEGPESFQLVEVAMGCRHVQRTVLMDEQPLLDRLQDIRQMSVRQV
SQTRFYVAESRDVASHVSLFVGGLPPGLSPEEYSSLLHEAVATKATVVSVSHVYSSQGAV
VLDIACFAEAERLYVLLKDIAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGLKG
RDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDGTVGWVLGALEETRY
RLACPEPSVAILPLGTGNDLGRVLRWGAGYSGEDPFSILLSVDEADAVLVDRWTILLDAH
EAVSAENGPADAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSRLHNKGVYVRV
GLQKISHSRSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDARFEKPRM
DDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMI
ISAAGPKVHMLRKAKQKPRRTGTTRDARVDAAPAPEGEPR
NT seq 2823 nt   +upstreamnt  +downstreamnt
atggcggcggcggccgagcccggggcccgcgcctggctgggcgacggctccccgcgcccc
ggcagcccggcctgcagccccgtgctgggcgcaggaggccgcgcgcgcccggggccgggg
ccgggaccggagcgggcaggcgccagagccccgggccccgctgccgcgccgggacacagc
ttccggaaggtgacgctcaccaagcccaccttctgccacctctgctccgacttcatctgg
gggctggccggcttcctgtgcgacgtctgcaatttcatgtctcatgagaagtgcctgaag
catgtgaggatcccgtgcacgagtgtggcgcccagcctggtccgggttcctgtggcccac
tgcttcggcccccgggggctccacaagcgcaagttctgtgctgtctgccgcaaggtcctg
gaggcgcctgcgctccactgcgaagtgtgtgagctgcacctccacccagactgtgtgccc
ttcgcctgcagtgactgccgccagtgccaccaggatgggcaccaggaccacgacacccat
caccaccactggcgggaggggaacctgccctcgggagcgcgctgcgaggtctgcaggaag
acgtgcggctcctctgacgtgctggctggcgtgcgctgcgagtggtgcggggtccaggcg
cactccgtctgctccgcggcgctggctcccgagtgtggcttcgggcgtctgcgctccctg
gtcctgccccccgcgtgcgtgcgccttctgcccggcggcttcagcaagatgcagagcttc
cgcatcgtggaggcagcggagccgggcgaggggggcgacggcgccgacgggagcgctgcc
gtgggtccaggcagagagacacaggcaactccggagtccgggaagcaaacgctgaagatc
tttgatggcgacgacgcggtgaggagaagccagttccgcctcatcactgtgtcccgcctg
gccggtgccgaggaggtgctggagaccgcactgcgggcccaccacatcccggaggaccct
ggccacctggagctgtgccggctgcccccttcctctcaggcctgtgatgcctgggctagg
ggcaaggccgggagtgctgtgatctcggaggaaggcagaagccccgggtccggcgaggcc
acgccagaggcctgggtcatccgggctctgccgcgggcccaggaggtcctgaagatctac
cctggctggctcaaggtgggcgtggcctacgtgtccgtgcgagtgaccccgaagagcacg
gcccgctctgtggtgctggaggtcctgccgctgctcggccgccaggccgagggtcccgag
agcttccagctggtggaggtggcaatgggctgcaggcacgtccagcggacggtgctgatg
gatgaacagcccctgctggaccggctacaggacatccggcagatgtccgtgcggcaggtg
agccagacgcggttctacgtggcagagagcagggatgtagcctcgcacgtctccctgttt
gttggtggcctgcctcccggcctgtcccccgaggagtacagcagcctgctgcatgaggcc
gtggctaccaaagccaccgtggtgtccgtgagtcacgtctactcctcccaaggtgcggta
gtgctggacatcgcctgctttgcggaggccgagcggctgtatgtgctgctgaaggacatt
gctgtgcggggccggctgctcactgccctggtgctccccgacctgctgcacgcgaagctg
cccccagacagctgtccccttcttgtgttcgtgaaccccaagagtggaggcctcaagggc
cgagacctgctctgcagcttccggaagctactgaaccctcaccaggtcttcgacctgacc
aatgggggtcctcttcctgggctccacctgttctcccaggtgccctgcttccgggtgctg
gtgtgtggtggcgatggcaccgtgggctgggtgctcggcgccctggaggagacacggtac
cgactggcctgcccggagccttctgtggccatcctgcccctgggcacagggaatgatctt
ggtcgagtcctccgctggggggcaggctacagcggcgaggacccattctccatactgctg
tccgtggacgaggccgacgccgtgctcgtggaccgctggaccatcctgctggatgcccac
gaggctgtcagtgcagagaacggcccggcagacgcagagccccccaagatcgtgcagatg
agtaactactgtggcattggcatcgacgcagagctgagcctggacttccaccaggcacgg
gaagaggagcctggcaagttcacaagcaggctgcacaacaagggtgtgtacgtacgggtg
gggctgcagaagatcagtcactctcggagcctgcacaagcagatccggctgcaggtggag
cggcaggaggtggagctgcccagtattgaaggcctcatcttcatcaacatccccagctgg
ggctcgggggccgacctgtggggctctgacagcgacgccaggtttgagaagccgcgcatg
gacgacgggctactggaggtggtgggcgtgacgggcgtcgtgcacatgggccaggtccag
ggtgggctgcgctccggaatccggattgcccagggttcctacttccgagtcacgctcctc
aaggccaccccggtgcaggtggacggggagccctgggtccaggccccagggcacatgatc
atctcagctgctggccctaaggtccacatgctgaggaaggccaagcagaagccgaggagg
accgggaccaccagggatgcccgggtggatgctgcgcctgcccctgagggcgagcctagg
tag

KEGG   Pongo abelii (Sumatran orangutan): 100460596
Entry
100460596         CDS       T01416                                 

Gene name
DGKG
Definition
(RefSeq) diacylglycerol kinase gamma isoform X1
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon00564  Glycerophospholipid metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
pon04072  Phospholipase D signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100460596 (DGKG)
   00564 Glycerophospholipid metabolism
    100460596 (DGKG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100460596 (DGKG)
   04072 Phospholipase D signaling pathway
    100460596 (DGKG)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100460596 (DGKG)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     100460596 (DGKG)
SSDB
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 100460596
NCBI-ProteinID: XP_024101100
Ensembl: ENSPPYG00000014377
LinkDB
Position
3
AA seq 791 aa
MGEERWVSLTPEEFDQLQKYSEYSSKKIKDVLTEFNKGGSLKQYDPQEPISYDVFKLFMR
AYLEVDLPQPLSTHLFLAFSQKPRQETSDHPTEGASNSEANSPDTNIQNADNATKADEAC
APDTESNMAKKQAPTEDQVAATPLEPPVPRSSSSESPMVYLKDVVCYLSLLETGRPQDKL
EFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFV
SLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFKKPTYCNFCHIMLMGVRKQGL
CCTYCKYTVHERCVSKNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDRCHKSIKCYQS
VTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGEL
VMQYKIIPTPGTHPLLVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFFH
DTPDFRVLACGGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSL
TKILKDIEQSPLVMLDRWHLEVIPREEVENGDQVPYSIMNNYFSIGVDASIAHRFHVMRE
KHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDHIELECDGVGVDLSNIFLEGIAILNI
PSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQDLSDQLLEVVGLEGAMEMGQIY
TGLKSAGKRLAQCSSVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSF
FSLRRKSRSKD
NT seq 2376 nt   +upstreamnt  +downstreamnt
atgggtgaagaacggtgggtctccctcactccagaagaatttgaccaactccagaaatat
tcagaatattcctccaagaagataaaagatgtcttgactgaatttaataagggtgggagc
ctcaaacaatatgacccacaggagccgattagctatgatgtcttcaagctgttcatgagg
gcatacctggaggtggaccttccccagccactgagcactcacctcttcctggccttcagc
cagaagcccagacaggagacctctgaccacccgacggagggagccagcaacagcgaggcc
aacagcccagatactaatatacagaatgcagataatgccaccaaagcagacgaggcctgt
gcccctgatactgaatcaaatatggctaagaagcaagcaccaactgaagaccaagtggct
gcaacccccctggaaccccccgtccctcggtcttcaagctcggaatcccccatggtgtac
ctgaaggatgttgtgtgctacctgtccctgctggagacggggaggcctcaggataagctg
gagttcatgtttcgcctctatgattcagatgagaacggtctcctggaccaagcggagatg
gattgcattgtcaaccaaatgctgcatattgcccagtacctggagtgggatcccacagag
ctgaggcctatattgaaggagatgctgcaagggatggactacgaccgggatggctttgtg
tctctacaggaatgggtccacggagggatgaccaccatcccattgctggtcctcctgggg
atggatgactctggctccaagggggatgggcggcacgcctggaccatgaagcacttcaag
aaaccaacctactgcaacttctgccatatcatgctcatgggcgtccgcaagcaaggcctg
tgctgcacttactgtaaatacactgtccacgaacgctgtgtgtccaaaaacattcctggt
tgtgtcaaaacgtactcaaaagccaaaaggagcggtgaggtgatgcagcacgcatgggtg
gaagggaactcctccgtcaagtgtgaccggtgccacaaaagtatcaagtgctaccagagt
gtcaccgcgcggcactgcgtgtggtgccggatgacgtttcaccgcaaatgtgaattatca
acgttgtgtgacggtggggaactcagagaccacatcttgctgcccacctccatatgcccc
atcacccgggacaggccaggtgagaagtctgatggctgcgtgtctgccaagggcgaactt
gtcatgcagtataagatcatccccaccccgggtacccaccccctgctggtcttggtgaac
cccaagagtggagggagacaaggagaaagaattcttcggaaattccactatctgctcaac
cccaaacaagttttcaacctggacaatggggggcctactccagggttgaactttttccat
gatactccagacttccgtgttttggcctgtggtggagatgggacagttggctggattttg
gattgcattgataaggccaactttgcaaagcatccaccagtggctgtcctgcctcttgga
acaggaaatgaccttgcccgttgtctccgctggggaggaggttatgaagggggcagcttg
acgaaaatcctgaaggacattgagcagagccccttggtgatgctggaccgctggcatctg
gaagtcatccccagagaggaagtggaaaacggggaccaggtcccatacagcatcatgaac
aactatttctccattggtgtggacgcttccattgcacacagattccatgtgatgagagag
aaacatcctgaaaaattcaacagcaggatgaagaacaagctgtggtactttgaatttggc
acctcggagacttttgcagcgacctgcaagaaactccatgaccacattgagttggagtgt
gatggggttggggtggacctgagcaacatcttcctggaaggcattgccattctcaacatt
cccagcatgtacggaggcaccaatctctggggagaaaacaagaagaaccgggctgtgatc
cgggaaagcaggaagggtgtcactgaccccaaagaactgaaattctgcgttcaagacctc
agtgaccaactccttgaagtggtggggctagaaggagccatggagatggggcagatctac
accggcctgaagagtgcaggcaagaggctggcccagtgctcctctgtcaccatcaggaca
aacaagctgctgccaatgcaagtggatggagaaccctggatgcagccatgttgcacgatt
aaaattactcacaagaaccaagcgcccatgatgatggggcctccccagaagagcagcttc
ttctcgttgagaaggaagagccgttcaaaagactaa

DBGET integrated database retrieval system