KEGG   Pongo abelii (Sumatran orangutan): 100172539
Entry
100172539         CDS       T01416                                 

Gene name
FGF7
Definition
(RefSeq) fibroblast growth factor 7 precursor
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172539 (FGF7)
   04014 Ras signaling pathway
    100172539 (FGF7)
   04015 Rap1 signaling pathway
    100172539 (FGF7)
   04020 Calcium signaling pathway
    100172539 (FGF7)
   04151 PI3K-Akt signaling pathway
    100172539 (FGF7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100172539 (FGF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172539 (FGF7)
  09162 Cancer: specific types
   05226 Gastric cancer
    100172539 (FGF7)
   05218 Melanoma
    100172539 (FGF7)
   05224 Breast cancer
    100172539 (FGF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100172539 (FGF7)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100172539 (FGF7)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100172539 (FGF7)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100172539 (FGF7)
SSDB
Motif
Pfam: FGF Fascin Gb3_synth
Other DBs
NCBI-GeneID: 100172539
NCBI-ProteinID: NP_001125621
Ensembl: ENSPPYG00000006463
UniProt: Q5RAY8 A0A2J8VBG1
LinkDB
Position
15
AA seq 194 aa
MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcacaaatggatactgacatggatcctgccaactttgctctacagatcgtgctttcac
attatctgtctagtgggtactatatctttagcttgcaatgacatgactccagagcaaatg
gctacaaatgtgaactgttccagccctgagcgacacacaagaagttatgattacatggaa
ggaggggatataagagtgagaagactcttctgtcgaacacagtggtacctgaggattgat
aaaagaggcaaagtaaaagggacccaagagatgaagaataattacaatatcatggaaatc
aggacagtggcagttgggattgtggcaatcaaaggggtggaaagtgaattctatcttgca
atgaacaaggaaggaaaactctatgcaaagaaagaatgcaatgaagattgtaacttcaaa
gaactaattctggaaaaccattacaatacatatgcatcagctaaatggacacacaatgga
ggggaaatgtttgttgccttaaatcaaaaggggattcctgtaagaggaaaaaaaacaaag
aaagaacaaaaaacagcccactttcttcctatggcaataacttaa

KEGG   Pongo abelii (Sumatran orangutan): 100172718
Entry
100172718         CDS       T01416                                 

Gene name
PDGFD
Definition
(RefSeq) platelet-derived growth factor D precursor
  KO
K05450  platelet derived growth factor C/D
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04810  Regulation of actin cytoskeleton
pon05215  Prostate cancer
pon05218  Melanoma
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172718 (PDGFD)
   04014 Ras signaling pathway
    100172718 (PDGFD)
   04015 Rap1 signaling pathway
    100172718 (PDGFD)
   04020 Calcium signaling pathway
    100172718 (PDGFD)
   04072 Phospholipase D signaling pathway
    100172718 (PDGFD)
   04151 PI3K-Akt signaling pathway
    100172718 (PDGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100172718 (PDGFD)
   04540 Gap junction
    100172718 (PDGFD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100172718 (PDGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100172718 (PDGFD)
  09162 Cancer: specific types
   05218 Melanoma
    100172718 (PDGFD)
   05215 Prostate cancer
    100172718 (PDGFD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100172718 (PDGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100172718 (PDGFD)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100172718 (PDGFD)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 100172718
NCBI-ProteinID: NP_001125790
Ensembl: ENSPPYG00000003821
UniProt: Q5RA73 A0A2J8XX72
LinkDB
Position
11
AA seq 370 aa
MHRLIFVCTLVCANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVRG
NGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASE
TNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMY
LDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQ
RCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcaccggctcatctttgtctgcactctagtctgcgcaaacttttgcagctgtcgggac
acttctgcaactccgcagagcgcgtccatcaaagctttgcgcaacgccaacctcaggcga
gatgagagcaatcacctcacagacttgtaccgaagagatgagaccatccaggtgagagga
aacggctacgtgcagagtcctagattcccgaacagctaccccaggaacctgctcctgaca
tggcggcttcactcccaggagaatacacggatacagctagtgtttgacaatcagtttgga
ttagaggaagcagaaaatgatatctgtaggtatgattttgtggaagttgaagatatatcc
gaaaccagtaccattattagaggacgatggtgtggacacaaggaagttcctccaaggata
aaatcaagaacgaaccaaattaaaatcacattcaagtccgatgactactttgtggctaaa
cctggattcaagatttattattctttgctggaagatttccaacccgcagcagcttcagag
accaactgggaatctgtcacaagctctatttcaggggtatcctataactctccatcagta
acggatcccactctgattgcggatgctctggacaaaaaaattgcagaatttgataccgtg
gaagatctgctgaagtacttcaatccagagtcatggcaagaagatcttgagaatatgtat
ttggacacccctcgttatcgaggcaggtcataccatgaccggaagtcaaaagttgacctg
gataggctcaatgatgatgccaagcgttacagttgcactcccaggaattactcggtcaat
ataagagaagagctgaagctggccaatgtggtcttctttccacgttgcctcctcgtgcag
cgctgtggaggaaactgtggctgtggaactgtcaactggaggtcctgcacatgcaattca
gggaaaaccgtgaaaaagtatcatgaggtattacagtttgagcctggccacatcaagagg
aggggcagagctaagaccatggctctggttgacatccagttggatcaccatgaacgatgc
gattgtatctgcagctcaagaccacctcgataa

KEGG   Pongo abelii (Sumatran orangutan): 100172994
Entry
100172994         CDS       T01416                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha precursor
  KO
K08774  transforming growth factor, alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04915  Estrogen signaling pathway
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05223  Non-small cell lung cancer
pon05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172994 (TGFA)
   04012 ErbB signaling pathway
    100172994 (TGFA)
   04014 Ras signaling pathway
    100172994 (TGFA)
   04151 PI3K-Akt signaling pathway
    100172994 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100172994 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172994 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100172994 (TGFA)
   05212 Pancreatic cancer
    100172994 (TGFA)
   05225 Hepatocellular carcinoma
    100172994 (TGFA)
   05214 Glioma
    100172994 (TGFA)
   05211 Renal cell carcinoma
    100172994 (TGFA)
   05215 Prostate cancer
    100172994 (TGFA)
   05223 Non-small cell lung cancer
    100172994 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100172994 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 100172994
NCBI-ProteinID: NP_001126045
Ensembl: ENSPPYG00000012322
UniProt: Q5R8W2
LinkDB
Position
2A
AA seq 160 aa
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSTLLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgcgctgggtattgtgttggccgcgtgc
caggccttggagaacagcacgtccccgctgagcgcagacccgcccgtggccgcagcagtg
gtgtcccattttaatgactgcccagattcccacactcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggtgca
cgctgtgagcatgcggacctcttggccgtggtggccgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtccttatcatcacatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagcaccctcctgaagggaagaaccgcttgctgccactcagaaacagtggtc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100174103
Entry
100174103         CDS       T01416                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04390  Hippo signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100174103 (FGF1)
   04014 Ras signaling pathway
    100174103 (FGF1)
   04015 Rap1 signaling pathway
    100174103 (FGF1)
   04390 Hippo signaling pathway
    100174103 (FGF1)
   04020 Calcium signaling pathway
    100174103 (FGF1)
   04151 PI3K-Akt signaling pathway
    100174103 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100174103 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174103 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100174103 (FGF1)
   05218 Melanoma
    100174103 (FGF1)
   05224 Breast cancer
    100174103 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100174103 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100174103 (FGF1)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100174103 (FGF1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100174103 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100174103
NCBI-ProteinID: NP_001127073
UniProt: Q5NVQ3
LinkDB
Position
5
AA seq 214 aa
MHHAATLSPFLQCLPDTGRESGLEGAGISHLLKCWMQPLRFGRSRKLRLESATSSSCWAM
AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQL
SAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKN
WFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 645 nt   +upstreamnt  +downstreamnt
atgcaccatgctgccacattatctccattcctccagtgcctgcctgacactggccgtgaa
tcagggctggaaggggcaggcatttctcatttactaaagtgctggatgcagcccttgagg
ttcggcagaagcagaaagctgcgtcttgaaagcgccacaagcagcagctgctgggccatg
gctgaaggggaaatcaccaccttcacagccctgaccgagaagtttaatctgcctccaggg
aattacaagaagcccaaactcctctactgtagcaacgggggccacttcttgaggatcctt
ccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcagctc
agtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttggcc
atggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttcctg
gaaaggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaagaat
tggtttgttggcctcaagaagaatggaagctgcaaacgcggtcctcggactcactatggc
cagaaagcaatcttgtttctccccctgccagtctcttccgattaa

KEGG   Pongo abelii (Sumatran orangutan): 100431992
Entry
100431992         CDS       T01416                                 

Gene name
FGF10
Definition
(RefSeq) fibroblast growth factor 10
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100431992 (FGF10)
   04014 Ras signaling pathway
    100431992 (FGF10)
   04015 Rap1 signaling pathway
    100431992 (FGF10)
   04020 Calcium signaling pathway
    100431992 (FGF10)
   04151 PI3K-Akt signaling pathway
    100431992 (FGF10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100431992 (FGF10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431992 (FGF10)
  09162 Cancer: specific types
   05226 Gastric cancer
    100431992 (FGF10)
   05218 Melanoma
    100431992 (FGF10)
   05224 Breast cancer
    100431992 (FGF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100431992 (FGF10)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100431992 (FGF10)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100431992 (FGF10)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100431992 (FGF10)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100431992
NCBI-ProteinID: XP_002815587
Ensembl: ENSPPYG00000015444
UniProt: A0A6D2WTR6 H2PFH8
LinkDB
Position
5
AA seq 207 aa
MWKWILTHCASAFPHLPGCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSPS
SAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVV
AVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALN
GKGAPRRGQKTRRKNTSAHFLPMVVHS
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgcccggctgctgc
tgctgctttttgttgctgttcttggtgtcttccgtccctgtcacctgccaagcccttggt
caggacatggtgtcaccagaggccaccaactcttcttcctcctccttctcctctccttcc
agcgcgggaaggcatgtgcggagctacaatcaccttcaaggagatgtccgctggagaaag
ctattctctttcaccaagtactttctcaagattgagaagaacgggaaggtcagcgggacc
aagaaggagaactgcccgtacagcatcctggagataacatcagtagaaatcggagttgtt
gccgtcaaagccattaacagcaactattacttagccatgaacaagaaggggaaactctat
ggctcaaaagaatttaacaatgactgtaagctgaaggagaggatagaggaaaatggatac
aatacctatgcatcatttaactggcagcataatgggaggcaaatgtatgtggcattgaat
ggaaaaggagctccaaggagaggacagaaaacacgaaggaaaaacacctctgctcacttt
cttccaatggtggtacactcatag

KEGG   Pongo abelii (Sumatran orangutan): 100432172
Entry
100432172         CDS       T01416                                 

Gene name
NTF3
Definition
(RefSeq) neurotrophin-3
  KO
K04356  neurotrophin 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100432172 (NTF3)
   04014 Ras signaling pathway
    100432172 (NTF3)
   04151 PI3K-Akt signaling pathway
    100432172 (NTF3)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100432172 (NTF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100432172 (NTF3)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100432172 (NTF3)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 100432172
NCBI-ProteinID: XP_002822842
UniProt: A0A2J8TB09
LinkDB
Position
12
AA seq 270 aa
MVTFATLLQVNKVMSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNK
LSKQMVDVKENYQSTLPKAEAPREPERGEPAKSEFQPVIAMDTELLRQQRRYNSPRVLLS
DSTPLEPPPLYLMEDYVGNPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAID
IRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRAL
TSENNKLVGWRWIRIDTSCVCALSRKIGRT
NT seq 813 nt   +upstreamnt  +downstreamnt
atggttacttttgccacgctcttacaggtgaacaaggtgatgtccatcttgttttatgtg
atatttctcgcttatctccgtggcatccaaggtaacaacatggatcaaaggagtttgcca
gaagactcgctcaattccctgattattaagctgatccaggcggatattttgaaaaacaag
ctctccaagcagatggtggacgttaaggaaaattaccagagcaccctgcccaaagcagag
gctccccgagagccggagcggggagagcccgccaagtccgaattccagccagtgattgca
atggacaccgaactgctgcgacaacagagacgctacaactcaccgcgggtcctgctgagc
gacagcacccccttggagcccccgcccttgtatctcatggaggattacgtgggcaacccc
gtggtggcgaacagaacatcacggcggaaacggtacgcggagcataagagtcaccgaggg
gagtactcggtatgtgacagtgagagtctgtgggtgaccgacaagtcatctgccatcgac
attcggggacaccaggtcacggtgctgggggagatcaaaacgggcaactctcccgtcaaa
caatatttttatgaaacgcgatgtaaggaagccaggccagtcaaaaacggttgcaggggc
attgatgataaacactggaactctcagtgcaaaacgtcccaaacctacgtccgagcactg
acttcagaaaacaataaactcgtgggctggcggtggatacggatagacacgtcctgtgtg
tgtgccttgtcgagaaaaatcggaagaacatga

KEGG   Pongo abelii (Sumatran orangutan): 100432789
Entry
100432789         CDS       T01416                                 

Gene name
FGF8
Definition
(RefSeq) fibroblast growth factor 8 isoform X1
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100432789 (FGF8)
   04014 Ras signaling pathway
    100432789 (FGF8)
   04015 Rap1 signaling pathway
    100432789 (FGF8)
   04020 Calcium signaling pathway
    100432789 (FGF8)
   04151 PI3K-Akt signaling pathway
    100432789 (FGF8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100432789 (FGF8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432789 (FGF8)
  09162 Cancer: specific types
   05226 Gastric cancer
    100432789 (FGF8)
   05218 Melanoma
    100432789 (FGF8)
   05224 Breast cancer
    100432789 (FGF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100432789 (FGF8)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100432789 (FGF8)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100432789 (FGF8)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100432789 (FGF8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100432789
NCBI-ProteinID: XP_024110054
LinkDB
Position
10
AA seq 244 aa
MGSPRSALSCLLLHLLVFCLQAQEGPGRGPALGREFASLFRAGREPQGVSQQVTVQSSPN
FTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETD
TFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYM
AFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWA
PEPR
NT seq 735 nt   +upstreamnt  +downstreamnt
atgggcagcccccgctccgcgctgagctgcctgctgttgcacttgctggtcttctgcctc
caagcccaggaaggcccgggcaggggccctgcgctgggcagggagttcgcttccctgttc
cgggctggccgggagccccagggtgtctcccaacaggtaactgttcagtcctcacctaat
tttacacagcatgtgagggagcagagcctggtgacggatcagctcagccgccgcctcatc
cggacctaccaactctacagccgcaccagcgggaagcacgtgcaggtcctggccaacaag
cgcatcaacgccatggcagaggacggcgaccccttcgcaaagctcatcgtggagacggac
acctttggaagcagagttcgagtccgaggagccgagacgggcctctacatctgcatgaac
aagaaggggaagctgatcgccaagagcaacggcaaaggcaaggactgcgtcttcacggag
attgtgctggagaacaactacacagcgctgcagaatgccaagtacgagggctggtacatg
gccttcacccgcaagggccggccccgcaagggctccaagacgcggcagcaccagcgtgag
gtccacttcatgaagcggctgccccggggccaccacaccaccgagcagagcctgcgcttc
gagttcctcaactacccgcccttcacgcgcagcctgcgcggcagccagaggacttgggcc
cccgagccccgatag

KEGG   Pongo abelii (Sumatran orangutan): 100433743
Entry
100433743         CDS       T01416                                 

Gene name
VEGFD
Definition
(RefSeq) vascular endothelial growth factor D
  KO
K05449  vascular endothelial growth factor C/D
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04668  TNF signaling pathway
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100433743 (VEGFD)
   04014 Ras signaling pathway
    100433743 (VEGFD)
   04015 Rap1 signaling pathway
    100433743 (VEGFD)
   04668 TNF signaling pathway
    100433743 (VEGFD)
   04020 Calcium signaling pathway
    100433743 (VEGFD)
   04151 PI3K-Akt signaling pathway
    100433743 (VEGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100433743 (VEGFD)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100433743 (VEGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100433743 (VEGFD)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100433743 (VEGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100433743 (VEGFD)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100433743 (VEGFD)
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 100433743
NCBI-ProteinID: XP_024096500
Ensembl: ENSPPYG00000020143
LinkDB
Position
X
AA seq 354 aa
MYREWVVVNIFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSE
DWKLWRCRLRLKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEV
ASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVP
VKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEE
NPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC
CQKHKLFHPDTCSCEDRCPFHTRTCANGKTACAKHCRFPKEKRAAQGPHSRKNP
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtacagagagtgggtagtggtgaatattttcatgatgttgtacgtccagctggtgcag
ggctccagtaatgaacatggaccagtgaagcggtcatctcagtccacattagaacgatct
gaacagcagatcagggctgcttctagtttggaggaactacttcgaattactcactctgag
gactggaagctgtggagatgcaggctgaggctcaaaagttttaccagtatggactctcgc
tcagcatcccatcggtcgactaggtttgcggcaactttctatgacattgaaacactaaaa
gttatagatgaagaatggcaaagaactcagtgcagccctagagaaacgtgtgtggaggtg
gccagtgagctggggaagagtaccaacacattcttcaagcccccttgtgtgaacgtgttc
cgatgtggtggctgttgcaatgaagagagccttatctgtatgaacaccagcacctcgtac
atttccaaacagctctttgagatatcagtgcctttgacatcagtacctgaattagtgcct
gttaaagttgccaatcatacaggttgtaagtgcttgccaacagccccccgccatccatac
tcaattatcagaagatccatccagatccctgaggaagatcgctgttcccattccaagaaa
ctgtgtcctattgacatgctatgggatagcaacaaatgtaaatgtgttttacaggaggag
aatccacttgctggaacagaagaccactctcatctccaggaaccagctctctgtgggcca
cacatgatgtttgacgaagatcgttgcgagtgtgtctgtaaaacaccatgtcccaaagat
ctaatccagcaccccaaaaactgcagttgctttgagtgcaaagaaagtctggagacctgc
tgccagaagcacaagctatttcacccagacacctgcagctgtgaggacagatgccccttt
cataccagaacatgtgcaaatggcaaaacagcgtgtgcaaagcattgccgctttccaaag
gagaaaagggctgcccaggggccccacagccggaagaatccttga

KEGG   Pongo abelii (Sumatran orangutan): 100434503
Entry
100434503         CDS       T01416                                 

Gene name
ANGPT4
Definition
(RefSeq) angiopoietin-4 isoform X1
  KO
K05467  angiopoietin 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100434503 (ANGPT4)
   04014 Ras signaling pathway
    100434503 (ANGPT4)
   04015 Rap1 signaling pathway
    100434503 (ANGPT4)
   04066 HIF-1 signaling pathway
    100434503 (ANGPT4)
   04151 PI3K-Akt signaling pathway
    100434503 (ANGPT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100434503 (ANGPT4)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100434503 (ANGPT4)
SSDB
Motif
Pfam: Fibrinogen_C
Other DBs
NCBI-GeneID: 100434503
NCBI-ProteinID: XP_002830192
Ensembl: ENSPPYG00000010861
UniProt: H2P1H0 A0A663D8Y0
LinkDB
Position
20
AA seq 503 aa
MLSQLAMLQGSLLLVVATMSAAQQTRQEADRGCETLVIQHGHCSYTFLLPKSEPCPPGPE
VSSDSNTLQRESLANPLRLGKLPTQRVKQLEQALQNNTQWLMKLERAIKTILRSKLEQVQ
QQMAQNQTAPMIELGTSLLNQTTAQTRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQ
LLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERG
LRGVRHNSSLLQDQQHSLRQLLVLLRDLVQERANASAPAFIMAGEQVFQDCAEIQRSGAS
ASGVYTIQVSNAMKSRKVFCDLQSSGGRWTVIQRRENGTVNFQRNWKDYKQGFGDPAGEH
WLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQ
SSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGIYYRAPNNKHKMDGIR
WHYFKGPSYSLRASRMMIRPLDI
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgctctctcagctagccatgctgcagggcagcctcctccttgtggttgccaccatgtct
gcggctcaacagacaaggcaggaggcggataggggctgcgagacccttgtaatccagcac
ggccactgtagctacaccttcttgctgcctaagtctgagccctgccctccagggcctgag
gtctccagtgactccaataccctccagagagaatcactggccaacccactgcgcctgggg
aagttgcctacccaacgggtcaaacagctggagcaggcactgcagaacaacacacagtgg
ctgatgaagctagagagggccatcaagacgatcttgaggtcgaagctggagcaggtccag
cagcaaatggcccagaatcagacggcccccatgatagagctgggcaccagcctcctgaac
cagaccactgcccagacccgcaagctgaccgacatggaggctcagctcctgaaccagaca
tcaagaatggatgcccagatgccggagacctttctgtccaccaacaagctggagaaccag
ctgctgctacagaggcagaagctccagcagcttcagggccaaaacagcgcgctcgagaag
cggttgcaggccctggagaccaagcagcaggaggagctggccagcatcctcagcaagaag
gcgaagctgctgaacacgctgagccgccagagcgccgccctcaccaacatcgagcgcggc
ctgcgcggtgtcaggcacaactccagcctcctgcaggaccagcagcacagcctgcgccag
ctgctggtgttgttgcgggacctggtgcaagaaagggctaacgcctcggccccggccttc
ataatggcaggtgaacaggtgttccaggactgtgcagagatccagcgctctggggccagt
gccagtggtgtctacaccatccaggtgtccaatgcaatgaagtccaggaaggtgttctgt
gacctgcagagcagtggaggcaggtggaccgtcatccagcgccgtgagaatggcaccgtg
aatttccagcggaattggaaggattacaaacagggcttcggagacccagccggggagcac
tggctcggcaatgaagtggtgcaccagctcaccagaagggcagcctactctctgcgtgtg
gagctgcaagactgggaaggccacgaggcctatgcccagtacgaacatttccacctgggc
agtgagaaccagctatacaggctttctgtggtcgggtacagcggctcagcagggcgccag
agcagcctggtcctgcagaacaccagctttagcacccttgactcagacaacgaccactgt
ctctgcaagtgcgcccaggtgatgtctggagggtggtggtttgatgcctgtggcctgtca
aacctcaatggcatctactaccgtgctcccaacaacaagcacaagatggacggcatccgc
tggcactacttcaagggccccagctactcactgcgtgcctctcgcatgatgatacggcct
ttggacatctaa

KEGG   Pongo abelii (Sumatran orangutan): 100437858
Entry
100437858         CDS       T01416                                 

Gene name
FGF5
Definition
(RefSeq) fibroblast growth factor 5 isoform X1
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100437858 (FGF5)
   04014 Ras signaling pathway
    100437858 (FGF5)
   04015 Rap1 signaling pathway
    100437858 (FGF5)
   04020 Calcium signaling pathway
    100437858 (FGF5)
   04151 PI3K-Akt signaling pathway
    100437858 (FGF5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100437858 (FGF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100437858 (FGF5)
  09162 Cancer: specific types
   05226 Gastric cancer
    100437858 (FGF5)
   05218 Melanoma
    100437858 (FGF5)
   05224 Breast cancer
    100437858 (FGF5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100437858 (FGF5)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100437858 (FGF5)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100437858 (FGF5)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100437858 (FGF5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100437858
NCBI-ProteinID: XP_002814964
Ensembl: ENSPPYG00000014880
UniProt: H2PDR2
LinkDB
Position
4
AA seq 268 aa
MSLSFLLLLFFTHLILSAWAHGEKCLAPKRQPGPAATDRNPRGSSSRQSSSSAMSSSSAS
SSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSI
LEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHR
TEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPP
SPIKPKVPLSAPRKNTNSVKYRLKFRFG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgagcttgtccttcctcctcctcctcttcttcacccacctgatcctcagcgcctgggct
cacggggagaagtgtctcgcccccaaacggcaacccggacccgctgccactgataggaac
cctagaggctccagcagcagacagagcagcagtagcgctatgtcttcctcttctgcctcc
tcctcccccgcagcttctctgggcagccaaggaagtggcttggagcagagcagtttccag
tggagcccctcggggcgccggaccggcagcctctactgcagagtgggcattggtttccat
ctgcagatctacccggatggcaaagtcaatggctcccacgaagccaatatgttaagtatt
ttggaaatatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaacaaa
tttttagcgatgtcaaaaaaaggaaaactccatgcaagtgccaagttcacagatgactgc
aagttcagggagcgttttcaagaaaacagctataatacctatgcctcagcaatacataga
actgaaaaaacagggcgggagtggtatgtggccctgaataaaagaggaaaagccaaacga
gggtgcagcccccgggttaaaccccagcacgtctctacgcattttctgccaagattcaag
cagtcggagcagccagaactttctttcacggttactgttcctgaaaagaaaaagccacct
agccctatcaagccaaaggttcccctttctgcacctcggaaaaataccaactcagtgaaa
tacagactcaagtttcgctttggataa

KEGG   Pongo abelii (Sumatran orangutan): 100437861
Entry
100437861         CDS       T01416                                 

Gene name
PDGFC
Definition
(RefSeq) platelet-derived growth factor C
  KO
K05450  platelet derived growth factor C/D
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04810  Regulation of actin cytoskeleton
pon05215  Prostate cancer
pon05218  Melanoma
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100437861 (PDGFC)
   04014 Ras signaling pathway
    100437861 (PDGFC)
   04015 Rap1 signaling pathway
    100437861 (PDGFC)
   04020 Calcium signaling pathway
    100437861 (PDGFC)
   04072 Phospholipase D signaling pathway
    100437861 (PDGFC)
   04151 PI3K-Akt signaling pathway
    100437861 (PDGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100437861 (PDGFC)
   04540 Gap junction
    100437861 (PDGFC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100437861 (PDGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100437861 (PDGFC)
  09162 Cancer: specific types
   05218 Melanoma
    100437861 (PDGFC)
   05215 Prostate cancer
    100437861 (PDGFC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100437861 (PDGFC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100437861 (PDGFC)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100437861 (PDGFC)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 100437861
NCBI-ProteinID: XP_024102123
LinkDB
Position
4
AA seq 345 aa
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFRTLEDLIRYLEPERWQVDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgagcctcttcgggcttctcctgctgacatctgccctggccggccagagacaggggact
caggcggaatccaacctgagcagtaaattccagttctccagcaacaaggaacagaacgga
gtacaagatcctcagcatgagagaattattactgtgtctactaatggaagtattcacagc
ccaaggtttcctcatacttatccaagaaatacggtcttggtatggagattagtagcagta
gaggaaaatgtatggatacaacttacatttgatgaaagatttgggcttgaagacccagaa
gatgacatatgcaagtatgattttgtagaagttgaggaacccagtgatggaactatatta
gggcgctggtgtggttctggtactgtaccaggaaaacagatttctaaaggaaatcaaatt
aggataagatttgtatctgatgaatattttccttctgaaccagggttctgcatccactac
aacattgtcatgccacaattcacagaagctgtgagtccttcagtgctacccccttcagct
ttgccactggacctgcttaataatgctataactgcctttcgtaccttggaagaccttatt
cgatatcttgaaccagagagatggcaggtggacttagaagatctatataggccaacttgg
caacttcttggcaaggcttttgtttttggaagaaaatccagagtggtggatctgaacctt
ctaacggaggaggtaagattatacagctgcacacctcgtaacttctcagtgtccataagg
gaagaactaaagagaaccgataccattttctggccaggttgtctcctggttaaacgctgt
ggtgggaactgtgcctgttgtctccacaattgcaatgaatgtcaatgtgtcccaagcaaa
gttactaaaaaataccacgaggtccttcagttgagaccaaagaccggtgtcaggggattg
cataaatcactcaccgacgtggccctggagcaccatgaggagtgtgactgtgtgtgcaga
gggagcacaggaggatag

KEGG   Pongo abelii (Sumatran orangutan): 100439010
Entry
100439010         CDS       T01416                                 

Gene name
FGF23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon04928  Parathyroid hormone synthesis, secretion and action
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100439010 (FGF23)
   04014 Ras signaling pathway
    100439010 (FGF23)
   04015 Rap1 signaling pathway
    100439010 (FGF23)
   04020 Calcium signaling pathway
    100439010 (FGF23)
   04151 PI3K-Akt signaling pathway
    100439010 (FGF23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100439010 (FGF23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100439010 (FGF23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100439010 (FGF23)
  09162 Cancer: specific types
   05226 Gastric cancer
    100439010 (FGF23)
   05218 Melanoma
    100439010 (FGF23)
   05224 Breast cancer
    100439010 (FGF23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100439010 (FGF23)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100439010 (FGF23)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100439010 (FGF23)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100439010 (FGF23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100439010
NCBI-ProteinID: XP_024113051
LinkDB
Position
12
AA seq 251 aa
MLGARLRLWVCALCSVCSVSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFNPENCRFQQQTL
ENGYDVYHSPQHHFLVSLGRVKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPVPRRHTRS
AEDDSERDPLKVLKPRARMTPAPASCSQELPSSEDNSPMASDPLGVVRGGRVNTHAGGTG
PEGCRPFPKFI
NT seq 756 nt   +upstreamnt  +downstreamnt
atgttgggggcccgcctcaggctctgggtctgtgccttgtgcagcgtctgcagcgtgagc
gtcctcagagcctatcccaatgcctccccactgctcggctccagctggggtggcctgatc
cacctgtacacagccacagccaggaacagctaccacctgcagatccacaagaatggccat
gtggatggcgcaccccatcagaccatctacagtgccctgatgatcagatcagaggatgct
ggctttgtggtgattacaggtgtgatgagcagaagatacctctgcatggatttcagaggc
aacatttttggatcacactatttcaacccagagaactgcaggttccaacagcagacgctg
gaaaacgggtatgacgtctaccactctcctcagcatcactttctggtcagtctgggccgg
gtgaagagagccttcctgccaggcatgaacccacccccgtactcccagttcctgtcccgg
aggaacgagatccccctaattcacttcaacacccccgtaccacgacggcacacccggagc
gccgaggatgactcggagcgggaccccctgaaagtgctgaagccccgggcccggatgacc
ccggccccggcctcctgctcacaggagctcccgagctccgaggacaacagcccgatggcc
agcgacccattaggggtggtcaggggcggtcgagtgaacacgcacgctgggggaacgggc
ccggaaggctgccgccccttccccaagttcatctag

KEGG   Pongo abelii (Sumatran orangutan): 100439816
Entry
100439816         CDS       T01416                                 

Gene name
FLT3LG
Definition
(RefSeq) fms-related tyrosine kinase 3 ligand isoform X1
  KO
K05454  fms-related tyrosine kinase 3 ligand
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100439816 (FLT3LG)
   04014 Ras signaling pathway
    100439816 (FLT3LG)
   04151 PI3K-Akt signaling pathway
    100439816 (FLT3LG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100439816 (FLT3LG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100439816 (FLT3LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100439816 (FLT3LG)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100439816 (FLT3LG)
SSDB
Motif
Pfam: Flt3_lig
Other DBs
NCBI-GeneID: 100439816
NCBI-ProteinID: XP_024093877
Ensembl: ENSPPYG00000010250
LinkDB
Position
19
AA seq 285 aa
MGRGRGGEAKGRAGQGLGHEGPRLVLLSLPRPGHRRHEGPPAEMTVLAPAWSPNTPPPLQ
TYLLLLLLLSSGLSRTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCG
ALWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLL
QETSEQLVALKPWITRQNFSRCLELQCQPDSSTLLPPWSPQPLEATAPTAPQPPLLLLLL
LPVGLLLLAAAWCLHWQRTRRRTPRPGEQGRTLRHTEGSHQPEDA
NT seq 858 nt   +upstreamnt  +downstreamnt
atgggacgcgggaggggcggggaggcaaaggggcgggcggggcaggggctggggcatgag
ggtccgagacttgttcttctgtcccttccaagacccggccacaggaggcatgaggggccc
ccggccgaaatgacagtgctggcgccagcctggagcccaaacacaccccctcccctgcag
acctatctcctcctgctgctgctgctgagctcgggactcagtaggacccaggactgctcc
ttccaacacagccccatctcctccgacttcgctgtcaaaatccgtgagctgtctgactac
ctgcttcaagattacccggtcaccgtggcctccaacctgcaggacgaggagctctgcggg
gccctctggcggctggtcctggcacagcgctggatggagcggctcaagactgtcgctggg
tccaagatgcaaggcttgctggagcgcgtgaacacggagatacactttgtcaccaaatgt
gcctttcagcccccccccagctgtcttcgcttcgtccagaccaacatctcccgcctcctg
caggagacctccgagcagctggtggcgctgaagccctggatcactcgccagaacttctcc
cgatgcctggagctgcagtgtcagcccgactcctcaaccctgctacccccatggagtccc
cagcccctggaggccacagccccgacagccccgcagccccctctgctcctcctactgctg
ctgcccgtgggcctcctgctgctggccgctgcctggtgcctgcactggcagaggacgcgg
cggaggacaccccgccctggggagcaggggaggacactgaggcacacagaggggagtcac
cagccagaggatgcatag

KEGG   Pongo abelii (Sumatran orangutan): 100440212
Entry
100440212         CDS       T01416                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05231  Choline metabolism in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100440212 (PDGFA)
   04014 Ras signaling pathway
    100440212 (PDGFA)
   04015 Rap1 signaling pathway
    100440212 (PDGFA)
   04630 JAK-STAT signaling pathway
    100440212 (PDGFA)
   04020 Calcium signaling pathway
    100440212 (PDGFA)
   04072 Phospholipase D signaling pathway
    100440212 (PDGFA)
   04151 PI3K-Akt signaling pathway
    100440212 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100440212 (PDGFA)
   04540 Gap junction
    100440212 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100440212 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440212 (PDGFA)
   05202 Transcriptional misregulation in cancer
    100440212 (PDGFA)
   05206 MicroRNAs in cancer
    100440212 (PDGFA)
   05231 Choline metabolism in cancer
    100440212 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    100440212 (PDGFA)
   05218 Melanoma
    100440212 (PDGFA)
   05215 Prostate cancer
    100440212 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100440212 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100440212 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100440212 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100440212 (PDGFA)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100440212 (PDGFA)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100440212 (PDGFA)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 100440212
NCBI-ProteinID: XP_024097071
LinkDB
Position
7
AA seq 220 aa
MRTLACLLLLGCGYLAHVLAEEAEIPREVIERLAHSQIHSIRDLQRLLEIDSVGSEESLD
TSLRVHGVHATKHASEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRIHHRSVKVAKVEYIRKKPKLKEVQVRLEEHLECACA
TTSLNPDYREEDTGEWLPSSASVLENRSSEPCFWGVRWPP
NT seq 663 nt   +upstreamnt  +downstreamnt
atgaggaccttggcttgcctgctgctcctcggctgcggatacctcgcccatgttctggcc
gaggaagccgagatcccccgcgaggtgatcgagaggctggcgcacagtcagatccacagc
atccgggacctccagcgactcctggagatagactccgtagggagtgaggagtctttggac
accagcctgagagttcacggggtccacgccactaagcatgcgtccgagaagcggcccctg
cccattcgaaggaagagaagcatcgaggaagctgtccccgctgtctgcaagaccaggacg
gtcatttacgagattcctcggagtcaggttgaccccacgtccgccaacttcctgatctgg
cccccgtgcgtggaggtgaaacgctgcaccggctgctgcaacaccagcagcgtcaagtgc
cagccctcacgcatccaccaccgcagtgtcaaggtcgccaaggtggaatacatcaggaag
aagccaaaattaaaagaagtccaggtgaggttagaggagcatttggagtgcgcctgcgcg
accaccagcctgaatccggattatcgggaagaggacacgggtgagtggctgccttcatcg
gcatcagtgttggagaacaggtcttcagagccgtgcttttggggtgttaggtggccccct
tga

KEGG   Pongo abelii (Sumatran orangutan): 100440363
Entry
100440363         CDS       T01416                                 

Gene name
FGF3
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100440363 (FGF3)
   04014 Ras signaling pathway
    100440363 (FGF3)
   04015 Rap1 signaling pathway
    100440363 (FGF3)
   04020 Calcium signaling pathway
    100440363 (FGF3)
   04151 PI3K-Akt signaling pathway
    100440363 (FGF3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100440363 (FGF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440363 (FGF3)
  09162 Cancer: specific types
   05226 Gastric cancer
    100440363 (FGF3)
   05218 Melanoma
    100440363 (FGF3)
   05224 Breast cancer
    100440363 (FGF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100440363 (FGF3)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100440363 (FGF3)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100440363 (FGF3)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100440363 (FGF3)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100440363
NCBI-ProteinID: XP_002821457
Ensembl: ENSPPYG00000002957
UniProt: H2NCJ6 A0A6D2XD77
LinkDB
Position
11
AA seq 239 aa
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER
IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHRDHEMVRQLQGGLPRPPGKGVQPRRRRQKQSPDSLEPSYVQAPRLGSQLEASAH
NT seq 720 nt   +upstreamnt  +downstreamnt
atgggcctaatctggctgctgctgctcagcctgctggagcccggctggcccgcagcgggc
cctggggcgcggttgcggcgcgatgcgggcggccgtggcggcgtctacgagcaccttggc
ggggcgccccggcgccgcaagctctactgcgccacgaagtaccacctccagctgcacccg
agcggccgcgtcaacggcagcctggagaacagcgcctacagtattctggagataacggca
gtggaggtgggcattgtggccatcaggggtctcttctccgggcggtacctggccatgaac
aagaggggacgactctatgcttcggagcactacagcgccgagtgcgagtttgtggagcgg
atccacgagctgggctataacacgtatgcctcccggctgtaccggacggtgtctagtacg
cctggggcccggcggcagcccagcgccgagagactgtggtacgtgtctgtgaacggcaag
ggccggccccgcaggggcttcaagacccgccgcacacagaagtcctccctgttcttgccc
cgcgtgctggaccacagggaccatgagatggtgcggcagctgcagggtgggctgcccaga
ccccctggtaagggggtccagccccgacggcggcggcagaagcagagcccggatagcctg
gagccctcgtacgttcaggccccgagactgggctcccagctggaggccagtgcgcactag

KEGG   Pongo abelii (Sumatran orangutan): 100440732
Entry
100440732         CDS       T01416                                 

Gene name
FGF4
Definition
(RefSeq) fibroblast growth factor 4
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100440732 (FGF4)
   04014 Ras signaling pathway
    100440732 (FGF4)
   04015 Rap1 signaling pathway
    100440732 (FGF4)
   04020 Calcium signaling pathway
    100440732 (FGF4)
   04151 PI3K-Akt signaling pathway
    100440732 (FGF4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100440732 (FGF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440732 (FGF4)
  09162 Cancer: specific types
   05226 Gastric cancer
    100440732 (FGF4)
   05218 Melanoma
    100440732 (FGF4)
   05224 Breast cancer
    100440732 (FGF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100440732 (FGF4)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100440732 (FGF4)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100440732 (FGF4)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100440732 (FGF4)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100440732
NCBI-ProteinID: XP_002821458
Ensembl: ENSPPYG00000002958
UniProt: H2NCJ7 A0A663D9Z2
LinkDB
Position
11
AA seq 206 aa
MSGPGTAAAALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVARSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
VERGVVSIFGVASRFFVAMSSRGKLYGSPFFTDECKFKEILLPNNYNAYESYKYPGMFIA
LSKNGKTKKGNRVSPTMKVTHFLPRL
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtcggggcccgggacggccgcggcagcgctgctcccggcggtcctgctggccttgctg
gcgccctgggcgggccgagggggcgccgccgcacccactgcacccaacggcacgctggag
gccgagctggagcgccgctgggagagcctggtggcgcgctcgttggcgcgcctgccggtg
gcagcgcaacccaaggaggcggccgtccagagcggcgccggcgactacctgctgggcatc
aagcggctgcggcggctctactgcaacgtgggcatcggcttccacctccaggcgctcccc
gacggccgcatcggcggcgcgcacgcggacacccgcgacagcctgctggagctctcgccc
gtggagcggggcgtggtgagcatcttcggcgtggccagccggttcttcgtggccatgagc
agcaggggcaagctctatggctcgcccttcttcaccgatgagtgcaagttcaaggagatt
ctcctccccaacaactacaacgcctacgagtcctacaagtaccccggcatgttcatcgcc
ctaagcaagaatgggaagaccaagaaggggaaccgagtgtcgcccactatgaaggtcacc
cacttcctccccaggctgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100440872
Entry
100440872         CDS       T01416                                 

Gene name
PGF
Definition
(RefSeq) placenta growth factor isoform X1
  KO
K16859  placenta growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100440872 (PGF)
   04014 Ras signaling pathway
    100440872 (PGF)
   04015 Rap1 signaling pathway
    100440872 (PGF)
   04151 PI3K-Akt signaling pathway
    100440872 (PGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100440872 (PGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440872 (PGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100440872 (PGF)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100440872 (PGF)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 100440872
NCBI-ProteinID: XP_024087732
LinkDB
Position
14
AA seq 170 aa
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNSSSEVEVVPFQEVWGRSYCRALERLVD
IVSEYPSEVEHIFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVEL
TFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
NT seq 513 nt   +upstreamnt  +downstreamnt
atgccggtcatgaggctgttcccttgcttcctgcagctcctggccgggctggcgctgcct
gctgtgcccccccagcagtgggccttgtctgctgggaacagctcgtcagaggtggaagtg
gtgcccttccaggaagtgtggggtcgcagctactgccgggcgctggagaggctggtggac
atcgtgtctgagtaccccagcgaggtggagcacatattcagcccatcctgtgtctccctg
ctgcgctgcaccggctgctgcggcgatgagaacctgcactgtgtgccagtggagacagcc
aatgtcaccatgcagctcctaaagatccgctctggggaccggccctcctacgtggagctg
acattctctcagcacgttcgctgcgagtgccggcctctgcgggagaagatgaagccggaa
aggaggagacccaagggcagggggaagaggaggagagagaagcagagacccacagactgc
cacctgtgcggcgatgctgttccccggaggtaa

KEGG   Pongo abelii (Sumatran orangutan): 100441475
Entry
100441475         CDS       T01416                                 

Gene name
FGF19
Definition
(RefSeq) fibroblast growth factor 19
  KO
K22603  fibroblast growth factor 19
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100441475 (FGF19)
   04014 Ras signaling pathway
    100441475 (FGF19)
   04015 Rap1 signaling pathway
    100441475 (FGF19)
   04020 Calcium signaling pathway
    100441475 (FGF19)
   04151 PI3K-Akt signaling pathway
    100441475 (FGF19)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100441475 (FGF19)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100441475 (FGF19)
  09162 Cancer: specific types
   05226 Gastric cancer
    100441475 (FGF19)
   05218 Melanoma
    100441475 (FGF19)
   05224 Breast cancer
    100441475 (FGF19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100441475 (FGF19)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100441475 (FGF19)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100441475 (FGF19)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100441475 (FGF19)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100441475
NCBI-ProteinID: XP_002821459
Ensembl: ENSPPYG00000002960
UniProt: A0A663D5M7 H2NCJ9
LinkDB
Position
11
AA seq 216 aa
MRSGCVVVHAWILAGLWLAVAGRPLAFSDSGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLR
RHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
NT seq 651 nt   +upstreamnt  +downstreamnt
atgcggagcgggtgtgtggtggtccacgcctggatcctggccggcctctggctggccgtg
gccgggcgccccctcgccttctcggactcggggccccacgtgcactacggctggggcgac
cccatccgcctgcggcacctgtacacctccggcccccacgggctctccagctgcttcctg
cgcatccgtgccgacggcgtcgtggactgcgcgcggggccagagcgcgcacagtttgctg
gagatcaaggcagtcgctctgcggaccgtggccatcaagggcgtgcacagcgtgcggtac
ctctgcatgggcgccgacggcaagatgcaggggctgcttcagtactcggaggaagactgt
gctttcgaggaggagatccgcccagatggctacaatgtgtaccgatccgagaagcaccgc
ctcccggtctccctgagcagtgccaaacagcggcagctgtacaagaacaggggctttctt
ccgctctctcatttcctgcccatgctgcccatggtcccagaggagcctgaggacctcagg
cgccacttggaatccgacatgttctcttcgcccctggagaccgacagcatggacccattt
gggcttgtcaccggactggaggccgtgaggagtcccagctttgagaaataa

KEGG   Pongo abelii (Sumatran orangutan): 100441497
Entry
100441497         CDS       T01416                                 

Gene name
NGF
Definition
(RefSeq) beta-nerve growth factor isoform X2
  KO
K02582  nerve growth factor, beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04722  Neurotrophin signaling pathway
pon04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100441497 (NGF)
   04014 Ras signaling pathway
    100441497 (NGF)
   04015 Rap1 signaling pathway
    100441497 (NGF)
   04020 Calcium signaling pathway
    100441497 (NGF)
   04151 PI3K-Akt signaling pathway
    100441497 (NGF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100441497 (NGF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100441497 (NGF)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100441497 (NGF)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100441497 (NGF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pon03110]
    100441497 (NGF)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100441497 (NGF)
Chaperones and folding catalysts [BR:pon03110]
 Intramolecular chaperones
  Others
   100441497 (NGF)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100441497 (NGF)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 100441497
NCBI-ProteinID: XP_002810435
LinkDB
Position
1
AA seq 241 aa
MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSTPAAAIA
ARVAGQTCNITVDPRLFKKRRLRSPRVLFSTQPPPEAADTQDLDFEVGGAAPFNRTHRSK
RSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCR
DPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRR
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccatgttgttctacactctgatcacagcttttctgatcggcatacaggcggaacca
cactcagagagcaatgtccctgcaggacacaccatcccccaagcccactggactaaactt
cagcattcccttgacaccgcccttcgcagagcccgcagcaccccggcagcggcgatagct
gcacgtgtggcagggcagacctgcaacattactgtggaccccaggctgtttaaaaagcgg
cgactccgttcaccccgtgtgctgtttagcacccagcccccacctgaagctgcagacact
caggatctggacttcgaggtcggtggtgctgcccccttcaacaggactcacaggagcaag
cggtcatcatcccaccccatcttccacaggggcgaattctcggtgtgtgacagtgtcagc
gtgtgggttggggataagaccaccgccacagacatcaagggcaaggaggtgatggtgttg
ggagaggtgaacattaacaacagtgtattcaaacagtacttttttgagaccaagtgccgg
gacccaaatcccgttgacagcgggtgccggggcattgactcaaagcactggaactcatat
tgtaccacaactcacacctttgtcaaggcgctgaccatggatggcaagcaggctgcctgg
cggtttatccggatcgacacggcctgtgtgtgtgtgctcagcaggaaggctgtgagaaga
gcctga

KEGG   Pongo abelii (Sumatran orangutan): 100443243
Entry
100443243         CDS       T01416                                 

Gene name
EREG
Definition
(RefSeq) proepiregulin
  KO
K09784  epiregulin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04151  PI3K-Akt signaling pathway
pon05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100443243 (EREG)
   04012 ErbB signaling pathway
    100443243 (EREG)
   04151 PI3K-Akt signaling pathway
    100443243 (EREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    100443243 (EREG)
SSDB
Motif
Pfam: EGF BCCT CD34_antigen
Other DBs
NCBI-GeneID: 100443243
NCBI-ProteinID: XP_002814919
Ensembl: ENSPPYG00000014837
UniProt: A0A6D2Y5Q2 H2PDL6
LinkDB
Position
4
AA seq 169 aa
MTAGKRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRV
AQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVA
LTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
NT seq 510 nt   +upstreamnt  +downstreamnt
atgaccgcggggaagaggatggagatgctctgtgccggcagggtccctgcgctgctgctc
tgcctgggttttcatcttctacaggcagtcctcagtacaactgtgattccatcatgtatc
ccaggagagtccagtgataactgcacagctttagttcagacagaagacaatccacgtgtg
gctcaagtgtcaataacaaagtgtagctctgacatgaatggctactgtttgcatggacag
tgcatctacctggtggacatgagtcaaaactactgcaggtgtgaagtgggttatactggt
gtccgatgtgaacacttctttttaaccgtccaccaacctttaagcaaagaatatgtggct
ttgaccgtgattcttattattttgtttcttatcacagtcgtcggttccacatattatttc
tgcagatggtacagaaatcgaaaaagtaaagaaccaaagaaggaatatgagagagttact
tcaggggatccagagttgccacaagtctga

KEGG   Pongo abelii (Sumatran orangutan): 100443606
Entry
100443606         CDS       T01416                                 

Gene name
AREG
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04390  Hippo signaling pathway
pon05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100443606 (AREG)
   04012 ErbB signaling pathway
    100443606 (AREG)
   04390 Hippo signaling pathway
    100443606 (AREG)
   04151 PI3K-Akt signaling pathway
    100443606 (AREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    100443606 (AREG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pon03110]
    100443606 (AREG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100443606 (AREG)
Chaperones and folding catalysts [BR:pon03110]
 Intramolecular chaperones
  Others
   100443606 (AREG)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100443606 (AREG)
SSDB
Motif
Pfam: FtsL EGF
Other DBs
NCBI-GeneID: 100443606
NCBI-ProteinID: XP_002814920
Ensembl: ENSPPYG00000014838
UniProt: H2PDL7
LinkDB
Position
4
AA seq 252 aa
MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSELSSGADYDYPEEYDNEPQIPGYIVDDSVRVEQVVKPPKNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAIAVITVQLRRRYIRKYEGEAEERKK
LRQENGNVHVIA
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagagccccgctgctaccgccagcgccggtggtgctgtcgctcttgatactcggctca
ggccattatgctgctggattggacctcaatgacacctactctgggaagcgtgaaccattt
tctggggatcacagtgctgatggatttgaggttacctcaagaagtgagatgtcttcagga
agtgagatttcccctgtgagtgaaatgccttctagtagtgaactgtcctcgggagccgac
tatgactacccagaagagtatgataatgaaccacaaatacctggctatattgtcgatgat
tcagtcagagttgaacaggtagttaagccccccaaaaacaagacggaaagtgaaaatact
tcagataaacccaaaagaaagaaaaagggaggcaaaaatggaaaaaatagaagaaacaga
aagaagaaaaatccatgtaatgcagaatttcaaaatttctgcattcacggagaatgcaaa
tatatagagcacctggaagcagtaacatgcaaatgtcagcaagaatatttcggtgaacgg
tgtggggaaaagtccatgaaaactcacagcatgattgacagtagtttatccaaaattgca
ttagcagccatagctgcctttatgtctgctgtgatcctcacagctattgctgttattaca
gtccagcttagaagacgatacatcaggaaatatgaaggagaagctgaggaacgaaagaaa
cttcgacaagagaatggaaatgtacatgttatagcataa

KEGG   Pongo abelii (Sumatran orangutan): 100443653
Entry
100443653         CDS       T01416                                 

Gene name
ANGPT1
Definition
(RefSeq) angiopoietin-1 isoform X1
  KO
K05465  angiopoietin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100443653 (ANGPT1)
   04014 Ras signaling pathway
    100443653 (ANGPT1)
   04015 Rap1 signaling pathway
    100443653 (ANGPT1)
   04066 HIF-1 signaling pathway
    100443653 (ANGPT1)
   04151 PI3K-Akt signaling pathway
    100443653 (ANGPT1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100443653 (ANGPT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100443653 (ANGPT1)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100443653 (ANGPT1)
SSDB
Motif
Pfam: Fibrinogen_C
Other DBs
NCBI-GeneID: 100443653
NCBI-ProteinID: XP_002819393
Ensembl: ENSPPYG00000018817
UniProt: A0A663DF10 H2PR10
LinkDB
Position
8
AA seq 498 aa
MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRA
TTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPLDF
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgacagttttcctttcctttgctttcctcgctgccattctgactcacatagggtgcagc
aaccagcgccgaagtccagaaaacagtgggagaagatataaccggattcaacatgggcaa
tgtgcctacactttcattcttccagaacacgatgggaactgtcgtgagagtacgacagac
cagtacaacacaaacgctctgcagagagatgctccacacgtggaaccggatttctcttcc
cagaaacttcaacatctggaacatgtgatggaaaattatactcagtggctgcaaaaactt
gagaattacattgtggaaaatatgaagtcggagatggcccagatacagcagaatgcagtt
cagaaccacacggctaccatgctggagataggaaccagcctcctgtctcagactgcagag
cagaccagaaagctgacagatgttgagacccaggtactaaatcaaacttctcgacttgag
atacagctgctggagaattcattatcaacctacaagctagagaagcaacttcttcaacag
acaaatgaaatcttgaagatccatgaaaaaaacagtttattagaacataaaatcttagaa
atggaaggaaaacacaaggaagagctggacaccttaaaggaagagaaagagaaccttcaa
ggcttggttactcgtcaaacatatataatccaggagctggaaaagcaattaaacagagct
accactaacaacagtgtccttcagaagcagcaactggagctgatggacacagtccacaac
cttgtcaacctttgcactaaagaaggtgttttactaaagggaggaaaaagagaggaagag
aaaccatttagagactgtgcagatgtatatcaagctggttttaataaaagtggaatctac
actatttatattaataatatgccagaacccaaaaaggtgttttgcaatatggatgtcaat
gggggaggttggactgtaatacaacatcgtgaagatggaagtctagatttccaaagaggc
tggaaagaatataaaatgggttttggaaatccctccggtgaatattggctggggaatgag
tttatttttgccattaccagtcagaggcagtacatgctaagaattgagttaatggactgg
gaagggaaccgagcctattcacagtacgacagattccacataggaaatgaaaagcaaaac
tataggttgtatttaaaaggtcacactgggacagcaggaaaacagagcagcctgatctta
cacggtgctgatttcagcactaaagatgctgataatgacaactgtatgtgcaaatgtgcc
ctcatgttaacaggaggctggtggtttgatgcttgtggcccctccaatctaaatggaatg
ttctatactgcgggacaaaaccatggaaaactgaatgggataaagtggcactacttcaaa
gggcccagttactctttacgttccacaactatgatgattcgacctttagatttttga

KEGG   Pongo abelii (Sumatran orangutan): 100444645
Entry
100444645         CDS       T01416                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X2
  KO
K05459  insulin-like growth factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04114  Oocyte meiosis
pon04115  p53 signaling pathway
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04935  Growth hormone synthesis, secretion and action
pon04960  Aldosterone-regulated sodium reabsorption
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05410  Hypertrophic cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100444645 (IGF1)
   04014 Ras signaling pathway
    100444645 (IGF1)
   04015 Rap1 signaling pathway
    100444645 (IGF1)
   04066 HIF-1 signaling pathway
    100444645 (IGF1)
   04068 FoxO signaling pathway
    100444645 (IGF1)
   04151 PI3K-Akt signaling pathway
    100444645 (IGF1)
   04152 AMPK signaling pathway
    100444645 (IGF1)
   04150 mTOR signaling pathway
    100444645 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100444645 (IGF1)
   04115 p53 signaling pathway
    100444645 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100444645 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100444645 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100444645 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    100444645 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    100444645 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100444645 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    100444645 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100444645 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    100444645 (IGF1)
   04213 Longevity regulating pathway - multiple species
    100444645 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100444645 (IGF1)
   05202 Transcriptional misregulation in cancer
    100444645 (IGF1)
   05205 Proteoglycans in cancer
    100444645 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    100444645 (IGF1)
   05218 Melanoma
    100444645 (IGF1)
   05215 Prostate cancer
    100444645 (IGF1)
   05224 Breast cancer
    100444645 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100444645 (IGF1)
   05414 Dilated cardiomyopathy
    100444645 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100444645 (IGF1)
   01522 Endocrine resistance
    100444645 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100444645 (IGF1)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100444645 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 100444645
NCBI-ProteinID: XP_002823703
Ensembl: ENSPPYG00000004882
UniProt: A0A663DE66 A0A2J8XMA1
LinkDB
Position
12
AA seq 159 aa
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKYQPPSTNKNTKSQRRRKGSTFEEHK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcactgtgcctgctc
accttcaccagctctgccacggctggaccggagacgctctgcggggctgagctggtggat
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtatggc
tccagcagtcggagggcgcctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctgaggaggctggagatgtattgtgcacccctcaagcctgccaaatcagcccgctct
gtccgtgcccagcgccacaccgacatgcccaagacccagaagtatcagcccccatctacc
aacaagaacacgaagtctcagaggagaaggaaaggaagtacatttgaagaacacaagtag

KEGG   Pongo abelii (Sumatran orangutan): 100447289
Entry
100447289         CDS       T01416                                 

Gene name
FGF21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04714  Thermogenesis
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100447289 (FGF21)
   04014 Ras signaling pathway
    100447289 (FGF21)
   04015 Rap1 signaling pathway
    100447289 (FGF21)
   04020 Calcium signaling pathway
    100447289 (FGF21)
   04151 PI3K-Akt signaling pathway
    100447289 (FGF21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100447289 (FGF21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100447289 (FGF21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447289 (FGF21)
  09162 Cancer: specific types
   05226 Gastric cancer
    100447289 (FGF21)
   05218 Melanoma
    100447289 (FGF21)
   05224 Breast cancer
    100447289 (FGF21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100447289 (FGF21)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100447289 (FGF21)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100447289 (FGF21)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100447289 (FGF21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100447289
NCBI-ProteinID: XP_002829565
Ensembl: ENSPPYG00000010214
UniProt: A0A6D2W2N6 A0A2J8U7P8
LinkDB
Position
19
AA seq 209 aa
MDSDETGFEHSGLWVPVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAH
LEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGI
LAPQPPDVGSSDPLSMVGPSQGRSPSYAS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggactcggacgagaccgggttcgagcactcaggactgtgggttcctgtgctggctggt
cttctgctgggagcctgccaggcacaccccatccctgactccagtcctctcctgcaattc
gggggccaagtccggcagcggtacctctacacagatgatgcccagcagacagaagcccac
ctggagatcagggaggatgggacggtggggggcgctgctgaccagagccccgaaagtctc
ctgcagctgaaagccttgaagccgggagttattcaaatcttgggagtcaagacatccagg
ttcctgtgccagaggccagatggggccctgtatggatcgctccactttgaccctgaggcc
tgcagcttccgggagctgcttcttgaggacggatacaatgtttatcagtccgaggcccat
ggcctcccgctgcatctgccgggaaacaagtccccacaccgggaccctgcaccccgagga
ccagctcgcttcctgccactaccaggcctgccccccgcacccccagagccgcccggaatc
ctggccccccagccccccgatgtgggctcctcggaccctctgagcatggtgggaccttcc
cagggccgaagccccagctatgcttcctga

KEGG   Pongo abelii (Sumatran orangutan): 100447350
Entry
100447350         CDS       T01416                                 

Gene name
BDNF
Definition
(RefSeq) brain-derived neurotrophic factor isoform X1
  KO
K04355  brain-derived neurotrophic factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04024  cAMP signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04722  Neurotrophin signaling pathway
pon05016  Huntington disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05030  Cocaine addiction
pon05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100447350 (BDNF)
   04014 Ras signaling pathway
    100447350 (BDNF)
   04024 cAMP signaling pathway
    100447350 (BDNF)
   04151 PI3K-Akt signaling pathway
    100447350 (BDNF)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100447350 (BDNF)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100447350 (BDNF)
   05022 Pathways of neurodegeneration - multiple diseases
    100447350 (BDNF)
  09165 Substance dependence
   05030 Cocaine addiction
    100447350 (BDNF)
   05034 Alcoholism
    100447350 (BDNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100447350 (BDNF)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100447350 (BDNF)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 100447350
NCBI-ProteinID: XP_002821977
Ensembl: ENSPPYG00000003401
LinkDB
Position
11
AA seq 304 aa
MRHLNAAATTAVGPAGSSTATATGAGRWSQNRNHDVTPPPGTRELCVDPEFHQVRRVMTI
LFLTMVISYFGCMKAAPMKEANVRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTF
EHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMS
MRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYE
TKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTI
KRGR
NT seq 915 nt   +upstreamnt  +downstreamnt
atgagacacttgaatgcagctgccaccactgccgtggggccggcgggaagcagcaccgcg
acggcgaccggggctgggcgctggagccagaatcggaaccacgatgtgactccgccgccg
gggacccgtgagctttgtgtggaccccgagttccaccaggtgagaagagtgatgaccatc
cttttccttactatggttatttcatactttggttgcatgaaggctgcccccatgaaagaa
gcaaacgtccgaggacaaggtggcttagcctacccaggtgtgcggacccatgggactctg
gagagcgtgaatgggcccaaggcgggttcaagaggcctgacatcgttggctgacactttc
gaacatgtgatagaagagctgttggatgaggaccagaaagttcggcccaatgaagaaaac
aataaggacgcagacttgtacacgtccagggtgatgctcagtagtcaagtgcctttggag
cctcctcttctctttctgctggaggaatacaaaaattacctagatgctgcaaacatgtcc
atgagggtccggcgccactctgaccctgcccgccgaggggagctgagcgtgtgtgacagt
attagcgagtgggtaacagcggcagacaaaaagactgcagtggacatgtcgggcgggacg
gtcacagtccttgaaaaggtccctgtatcaaaaggccaactgaagcaatacttctacgag
accaagtgcaatcccatgggttacacaaaagaaggctgcaggggcatagacaaaaggcat
tggaactcccagtgccgaactacccagtcgtacgtgcgggcccttaccatggatagcaaa
aagagaattggctggcgattcataaggatagacacttcttgtgtatgtacattgaccatt
aaaagaggaagatag

KEGG   Pongo abelii (Sumatran orangutan): 100448360
Entry
100448360         CDS       T01416                                 

Gene name
EFNA1
Definition
(RefSeq) ephrin-A1
  KO
K05462  ephrin-A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100448360 (EFNA1)
   04014 Ras signaling pathway
    100448360 (EFNA1)
   04015 Rap1 signaling pathway
    100448360 (EFNA1)
   04151 PI3K-Akt signaling pathway
    100448360 (EFNA1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100448360 (EFNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100448360 (EFNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100448360 (EFNA1)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100448360 (EFNA1)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100448360 (EFNA1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100448360 (EFNA1)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 100448360
NCBI-ProteinID: XP_002810122
Ensembl: ENSPPYG00000000759
UniProt: H2N5I2 A0A663D7A2
LinkDB
Position
1
AA seq 205 aa
MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVA
DAAMEQYILYLVEREEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEF
KEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIG
HSAAPRLFPLAWTVLLLPLLLLQTP
NT seq 618 nt   +upstreamnt  +downstreamnt
atggagttcctctgggcccctctcttgggtctgtgctgcagtctggccgctgctgatcgc
cacaccgtcttctggaacagttcaaatcccaagttccggaatgaggactacaccatacat
gtgcagctgaatgactacgtggacatcatctgtccgcactatgaggatcactctgtggca
gacgctgccatggagcagtacatactgtacctggtggagcgtgaggagtaccagctgtgc
cagccccagtccaaggaccaagtccgctggcagtgcaaccggcccagtgccaagcatggc
ccggagaaactgtctgagaagttccagcgcttcacacctttcaccctgggcaaggagttc
aaagaaggacacagctactactacatctccaaacccatccaccagcatgaagaccgctgc
ttgaggttgaaggtgactgtcagtggcaaaatcactcacagtcctcaggcccacgacaat
ccacaggagaagagacttgcagcagatgacccagaggtgcgggttctacatagcatcggt
cacagtgctgccccacgcctcttcccacttgcctggactgtgctgctcctgccacttctg
ctgctgcaaaccccgtga

KEGG   Pongo abelii (Sumatran orangutan): 100448388
Entry
100448388         CDS       T01416                                 

Gene name
FGF22
Definition
(RefSeq) fibroblast growth factor 22 isoform X1
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100448388 (FGF22)
   04014 Ras signaling pathway
    100448388 (FGF22)
   04015 Rap1 signaling pathway
    100448388 (FGF22)
   04020 Calcium signaling pathway
    100448388 (FGF22)
   04151 PI3K-Akt signaling pathway
    100448388 (FGF22)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100448388 (FGF22)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100448388 (FGF22)
  09162 Cancer: specific types
   05226 Gastric cancer
    100448388 (FGF22)
   05218 Melanoma
    100448388 (FGF22)
   05224 Breast cancer
    100448388 (FGF22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100448388 (FGF22)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100448388 (FGF22)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100448388 (FGF22)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100448388 (FGF22)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100448388
NCBI-ProteinID: XP_024093684
LinkDB
Position
19
AA seq 192 aa
MRRRLWLGLAWLLLAPAPDAAGTPSALRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGR
VQGTRWRHGQDSILEIRSVRVGVVVIKAVSSGFYVAMNRRGRLYGSVPGAHRRDRPQHLR
LTVLAPPRPAHVPGTGQAGGAPARRPDAAVPPVRPLPARPGLLRPREAGGFPRCLGWWRG
ARPRLFFPLLAP
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcgccgccgcctgtggctgggcctggcctggctgctgctggcgccggcgccggacgcc
gcgggaaccccgagcgcgctgcggggaccgcgcagctacccgcacctggagggcgacgtg
cgctggcggcgcctcttctcctccactcacttcttcctgcgcgtggatcccggcggccgc
gtgcagggcacccgctggcgccacggccaggacagtatcctggagatccgctctgtacgc
gtgggcgtcgtggtcatcaaagcagtgtcctcaggcttctacgtggccatgaaccgccgg
ggccgcctctacgggtcggttccgggagcgcatcgaagagaccggccacaacacctacgc
ctcacagtgctggcgccgccacggccagcccatgttcctggcactggacaggcagggggg
gccccggccaggcggccggacgcggcggtaccacctgtccgcccacttcctgcccgtcct
ggtctcctgaggccccgagaggccggcggcttcccaaggtgcctgggctggtggcgaggg
gcccggccacgcttgttcttccccttgctggctccctaa

KEGG   Pongo abelii (Sumatran orangutan): 100448769
Entry
100448769         CDS       T01416                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A isoform X1
  KO
K05448  vascular endothelial growth factor A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04370  VEGF signaling pathway
pon04510  Focal adhesion
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05219  Bladder cancer
pon05323  Rheumatoid arthritis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100448769 (VEGFA)
   04014 Ras signaling pathway
    100448769 (VEGFA)
   04015 Rap1 signaling pathway
    100448769 (VEGFA)
   04370 VEGF signaling pathway
    100448769 (VEGFA)
   04066 HIF-1 signaling pathway
    100448769 (VEGFA)
   04020 Calcium signaling pathway
    100448769 (VEGFA)
   04151 PI3K-Akt signaling pathway
    100448769 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100448769 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100448769 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100448769 (VEGFA)
   05206 MicroRNAs in cancer
    100448769 (VEGFA)
   05205 Proteoglycans in cancer
    100448769 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100448769 (VEGFA)
   05211 Renal cell carcinoma
    100448769 (VEGFA)
   05219 Bladder cancer
    100448769 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100448769 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100448769 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100448769 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100448769 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100448769 (VEGFA)
   05165 Human papillomavirus infection
    100448769 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100448769 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100448769 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100448769 (VEGFA)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100448769 (VEGFA)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100448769 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 100448769
NCBI-ProteinID: XP_024104065
LinkDB
Position
6
AA seq 215 aa
MNFLLSWVHWSFALLLYLHHAKWSQAAPMVEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQ
DPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaactttctgctgtcttgggtgcattggagctttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggtagaaggaggagggcagaatcatcacgaagtg
gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac
atcttccaggagtaccctgatgagatcgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgcgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgttccctgtgggccttgctcagagcggagaaagcatttgtttgtacaa
gatccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcag
cttgagttaaacgaacgtacttgcagatgtgacaagccgaggcggtga

KEGG   Pongo abelii (Sumatran orangutan): 100448970
Entry
100448970         CDS       T01416                                 

Gene name
EFNA3
Definition
(RefSeq) ephrin-A3 isoform X1
  KO
K05462  ephrin-A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100448970 (EFNA3)
   04014 Ras signaling pathway
    100448970 (EFNA3)
   04015 Rap1 signaling pathway
    100448970 (EFNA3)
   04151 PI3K-Akt signaling pathway
    100448970 (EFNA3)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100448970 (EFNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100448970 (EFNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100448970 (EFNA3)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100448970 (EFNA3)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100448970 (EFNA3)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100448970 (EFNA3)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 100448970
NCBI-ProteinID: XP_002810124
Ensembl: ENSPPYG00000000760
UniProt: H2N5I3
LinkDB
Position
1
AA seq 238 aa
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGVGPGAGPGPGGGAEQYVVYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI
KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPT
LPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggcggctccgttgctgctgctgctgctgctcgtgcccgtgccgctgctgccgctg
ctggcccaagggcccggaggggcgctgggaaaccggcatgcggtgtactggaacagctcc
aaccagcacctgcggcgagagggctacaccgtgcaggtgaacgtgaacgactatctggat
atttactgcccgcactacaacagctcgggggtgggccccggggcggggccggggcccgga
ggcggggcagagcagtacgtggtgtacatggtgagccgcaacggctaccgcacctgcaac
gccagccagggcttcaagcgctgggagtgcaaccggccgcacgccccgcacagccccatc
aagttctcggagaagttccagcgctacagcgccttctcgctgggctacgagttccacgct
ggccacgagtactactacatctccacgcccactcacaacctgcactggaagtgtctgagg
atgaaggtgttcgtctgctgcgcctccacatcgcactccggggagaagccggtccccact
ctcccccagttcaccatgggccccaatgtgaagatcaacgtgctggaagactttgaggga
gagaaccctcaggtgcccaagcttgagaagagcatcagcgggaccagccccaaacgggaa
cacctgcccctggccgtgggcatcgccttcttcctcatgacgttcttggcctcctag

KEGG   Pongo abelii (Sumatran orangutan): 100449916
Entry
100449916         CDS       T01416                                 

Gene name
EFNA4
Definition
(RefSeq) ephrin-A4 isoform X2
  KO
K05462  ephrin-A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100449916 (EFNA4)
   04014 Ras signaling pathway
    100449916 (EFNA4)
   04015 Rap1 signaling pathway
    100449916 (EFNA4)
   04151 PI3K-Akt signaling pathway
    100449916 (EFNA4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100449916 (EFNA4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100449916 (EFNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100449916 (EFNA4)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100449916 (EFNA4)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100449916 (EFNA4)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100449916 (EFNA4)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 100449916
NCBI-ProteinID: XP_002810129
Ensembl: ENSPPYG00000000761
UniProt: H2N5I4
LinkDB
Position
1
AA seq 201 aa
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPH
YEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSL
GFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDT
PSPLCLLLLLLLLILRLLRIL
NT seq 606 nt   +upstreamnt  +downstreamnt
atgcggctgctgcccctgctgcggactgtcctctgggccgcgttcctcggctcccctctg
cgcgggggctccagcctccgccacgtagtctactggaactccagtaaccccaggttgctt
cgaggagacgccgtggtggagctgggcctcaacgattacctagacattgtctgcccccac
tatgaaggcccagggccccctgagggccccgagacgtttgctttatacatggtggactgg
ccaggctatgagtcctgccaggcagagggcccccgggcctacaagcgctgggtgtgctcc
ctgccctttggccatgtccaattctcagagaagattcagcgcttcacacccttctccctc
ggctttgagttcttacctggagagacttactactacatctcggtgccaactccagagagt
tctggccagtgcttgaggctccaggtgtctgtctgctgcaaggagaggaagtctgagtca
gcccatcctgttgggagccctggagagagtggcacatcagggtggcgagggggggacact
cccagccccctctgtctcttgctattactgctgctcctgattcttcgtcttctgcgaatt
ctgtga

KEGG   Pongo abelii (Sumatran orangutan): 100450364
Entry
100450364         CDS       T01416                                 

Gene name
FGF17
Definition
(RefSeq) fibroblast growth factor 17 isoform X2
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100450364 (FGF17)
   04014 Ras signaling pathway
    100450364 (FGF17)
   04015 Rap1 signaling pathway
    100450364 (FGF17)
   04020 Calcium signaling pathway
    100450364 (FGF17)
   04151 PI3K-Akt signaling pathway
    100450364 (FGF17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100450364 (FGF17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450364 (FGF17)
  09162 Cancer: specific types
   05226 Gastric cancer
    100450364 (FGF17)
   05218 Melanoma
    100450364 (FGF17)
   05224 Breast cancer
    100450364 (FGF17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100450364 (FGF17)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100450364 (FGF17)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100450364 (FGF17)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100450364 (FGF17)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 100450364
NCBI-ProteinID: XP_002818910
Ensembl: ENSPPYG00000018409
UniProt: A0A2J8X4E0
LinkDB
Position
8
AA seq 205 aa
MGAARLLPNLTLCLQLLILCCQTQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGR
RISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTE
IVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEK
QKQFEFVGSAPTRRTKRTRRPQPLT
NT seq 618 nt   +upstreamnt  +downstreamnt
atgggagccgcccgcctgctgcccaacctcactctgtgcttacagctgctgattctctgc
tgtcaaactcagtacgtgagggaccagggcgccatgaccgaccagctgagcaggcggcag
atccgtgagtaccaactctacagccggaccagtggcaagcacgtgcaggtcaccgggcgt
cgcatctccgccaccgcagaggacggcaacaagtttgccaagctcatagtggagacggac
acgtttggcagccgggttcgcatcaaaggggctgagagcgagaagtacatctgtatgaac
aagaggggcaagctcatcgggaagcccagcgggaagagcaaagactgcgtgttcacggag
atcgtgctggagaacaactacacggccttccagaacgcccggcacgagggctggttcatg
gccttcacgcggcaggggcggccccgccaggcttcccgcagccgccagaaccagcgcgag
gcccacttcatcaagcgcctctaccaaggccagctgcccttccccaaccacgccgagaag
cagaagcagttcgagtttgtgggctccgcccccacccgccggaccaagcgcacgcggcgg
ccccagcccctcacgtag

KEGG   Pongo abelii (Sumatran orangutan): 100451193
Entry
100451193         CDS       T01416                                 

Gene name
EFNA5
Definition
(RefSeq) ephrin-A5
  KO
K05462  ephrin-A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100451193 (EFNA5)
   04014 Ras signaling pathway
    100451193 (EFNA5)
   04015 Rap1 signaling pathway
    100451193 (EFNA5)
   04151 PI3K-Akt signaling pathway
    100451193 (EFNA5)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100451193 (EFNA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100451193 (EFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100451193 (EFNA5)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100451193 (EFNA5)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100451193 (EFNA5)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100451193 (EFNA5)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 100451193
NCBI-ProteinID: XP_002815814
Ensembl: ENSPPYG00000015670
UniProt: H2PG80 A0A6D2Y360
LinkDB
Position
5
AA seq 228 aa
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgttgcacgtggagatgttgacgctggtgtttctggtgctctggatgtgtgtgttcagc
caggacccgggctccaaggccgtcgccgaccgctacgctgtctactggaacagcagcaac
cccagattccagaggggtgactaccatattgatgtctgtatcaatgactacctggatgtt
ttctgccctcactatgaggactccgtcccagaagataagactgagcgctatgtcctgtac
atggtgaactttgatggctacagtgcctgcgaccacacttccaaagggttcaagagatgg
gaatgtaaccggcctcactctccaaatggaccactgaagttctctgaaaaattccagctc
ttcactcccttttctctaggatttgaattcaggccaggccgagaatatttctacatctcc
tctgcaatcccagataatggaagaaggtcctgtctaaagctcaaagtctttgtgagaccg
acaaatagctgtatgaaaactataggtgttcatgatcgtgttttcgatgttaacgacaaa
gtagaaaattcattagaaccagcagatgacaccgtacatgagtcagccgagccatcccgc
ggcgagaacgcggcacaaacaccaaggatacccagccgccttttggcaatcctactgttc
ctcctggcgatgcttttgacattatag

KEGG   Pongo abelii (Sumatran orangutan): 100452144
Entry
100452144         CDS       T01416                                 

Gene name
CSF1
Definition
(RefSeq) macrophage colony-stimulating factor 1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04151  PI3K-Akt signaling pathway
pon04380  Osteoclast differentiation
pon04640  Hematopoietic cell lineage
pon04668  TNF signaling pathway
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100452144 (CSF1)
   04014 Ras signaling pathway
    100452144 (CSF1)
   04015 Rap1 signaling pathway
    100452144 (CSF1)
   04668 TNF signaling pathway
    100452144 (CSF1)
   04151 PI3K-Akt signaling pathway
    100452144 (CSF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100452144 (CSF1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100452144 (CSF1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100452144 (CSF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100452144 (CSF1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100452144 (CSF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100452144 (CSF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100452144 (CSF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100452144 (CSF1)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100452144 (CSF1)
SSDB
Motif
Pfam: CSF-1
Other DBs
NCBI-GeneID: 100452144
NCBI-ProteinID: XP_024113267
Ensembl: ENSPPYG00000001059
LinkDB
Position
1
AA seq 554 aa
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSVTEEVSEYCSHMIGSGHLQSLQRLIDSQME
TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK
SCFTKDYEEHDKACIRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP
LHMVDPGSAKQRPPRSTCQSLEPPETPVVKDSTIGGSPQPRPSVRAFNPGMEDVLDSAMG
TNWVPEEASGEASEIPVPQGTELSPSRPGEGSMQTEPARPSNFLSASSPLPESAKGQQPA
DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGFPRISSPRPQGLSNPSTLS
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPSEPEGGPASEGAARPLARFNSVPLTDTG
HERQPEGSSSLQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSRQEPQRADSPLEQPEG
SPLTQDDRQVELPV
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgaccgcgccgggcgccgccgggcgctgccctcccacgacatggctgggctccctgctg
ttgttggtctgtctcctggcgagcaggagtgtcaccgaggaggtgtcggagtactgtagc
cacatgattgggagtggacacctgcagtctctgcagcggctgattgacagtcagatggag
acctcgtgccaaattacctttgagtttgtagaccaggaacagttgaaagatccggtgtgc
taccttaagaaggcatttctcctggtacaagacataatggaggacaccatgcgcttcaga
gataacacccccaatgccatcgccattgtgcagctgcaggaactctctttgaggctgaag
agctgcttcaccaaggattatgaagagcatgacaaggcctgcatccgaactttctatgag
acacctctccagttgctggagaaggtcaagaatgtctttaatgaaacaaagaatctcctt
gacaaggactggaatattttcagcaagaactgcaacaacagctttgctgaatgctccagc
caagatgtggtgaccaagcctgattgcaactgcctgtaccccaaagccatccctagcagt
gacccggcctctgtctcccctcatcagcccctcgccccctccatggcccctgtggctggc
ttgacctgggaggactctgagggaactgagggcagctccctcttgcctggtgagcagccc
ctgcacatggtggatccaggcagtgccaagcagcggccacccaggagcacctgccagagc
cttgagccgccagagaccccagttgtcaaggacagcaccatcggtggctcaccacagcct
cgcccctctgtccgggccttcaaccccgggatggaggatgttctcgactctgcaatgggc
actaattgggtcccagaagaagcctctggagaggccagtgagattcccgtaccccaaggg
acagagctttccccctccaggccaggagagggcagcatgcagacagagcccgccagaccc
agcaacttcctctcagcatcttctccactccctgaatcagcaaagggccaacagccggca
gatgtaactggtaccgccttgcccagggtgggccccgtgaggcccactggccaggactgg
aatcacaccccccagaagacagaccatccatctgccctgctcagagaccccccggagcca
ggctttcccaggatctcatcaccgcgcccccaaggcctcagcaacccctccaccctctct
gctcagccacagctttccagaagccactcctcgggcagcgtgctgccccttggggagctg
gagggcagaaggagtaccagggatcggaggagcccctcagagccagaaggaggaccagca
agtgaaggggcagccaggcccctggcccgttttaactccgttcctttgactgacacaggc
catgagaggcagcccgagggatcctccagcctgcagctccaggagtctgtcttccacctg
ctggtgcccagtgtcatcctggtcttgctggccgtcggaggcctcttgttctacaggtgg
aggcggcggagccgtcaagagcctcagagagcggattctcccttggagcagccagagggc
agccccctgactcaggatgacagacaggtggaactgccagtgtag

KEGG   Pongo abelii (Sumatran orangutan): 100453191
Entry
100453191         CDS       T01416                                 

Gene name
VEGFC
Definition
(RefSeq) vascular endothelial growth factor C isoform X1
  KO
K05449  vascular endothelial growth factor C/D
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04668  TNF signaling pathway
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100453191 (VEGFC)
   04014 Ras signaling pathway
    100453191 (VEGFC)
   04015 Rap1 signaling pathway
    100453191 (VEGFC)
   04668 TNF signaling pathway
    100453191 (VEGFC)
   04020 Calcium signaling pathway
    100453191 (VEGFC)
   04151 PI3K-Akt signaling pathway
    100453191 (VEGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100453191 (VEGFC)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100453191 (VEGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100453191 (VEGFC)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100453191 (VEGFC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100453191 (VEGFC)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100453191 (VEGFC)
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 100453191
NCBI-ProteinID: XP_024101974
LinkDB
Position
4
AA seq 418 aa
MHLLGFFSLACSLLAAALLPGPREAPAAAAFESGLDLSDAEPDAGEATAYASKDLEEQLR
SVSSVDELMTVLYPEYWKMYKCQLRKGGWQHYREQTNLNSRTEETIKFAAAHYNTEILKS
IDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYL
SKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANK
TCPTNYMWNNHICRCLAQEDFMFSSDARDDSTDGFHDICGPNKELDEETCQCVCRAGLRP
VSCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCACE
CTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgcacttgctgggcttcttctctctggcgtgttctctgctcgccgctgcgctgctcccg
ggtcctcgcgaggcgcccgccgccgccgccttcgagtccggactcgacctctcggacgcc
gagcccgacgcgggcgaggccacggcttatgcaagcaaagatctggaggagcagttacgt
tctgtgtccagtgtagatgaactcatgactgtactctacccagaatattggaaaatgtac
aagtgtcagctaaggaaaggaggctggcaacattacagagaacagaccaacctcaactca
aggacagaagagactataaaatttgctgcagcacattataatacagagatcttgaaaagt
attgataatgagtggagaaagactcaatgcatgccacgggaggtgtgtatagatgtgggg
aaggagtttggagtcgcaacaaacaccttctttaaacctccatgtgtgtccgtctacaga
tgtgggggttgctgcaacagtgaggggctacagtgcatgaacaccagcacaagctacctc
agcaagacgttatttgaaattacagtgcctctctctcaaggccccaaaccagtaacaatc
agttttgccaatcacacttcctgccgatgcatgtctaaactggatgtttacagacaagtt
cattccattattagacgttccctgccagcaacactaccacagtgtcaggcagcgaacaag
acttgccccaccaattacatgtggaataatcacatctgcagatgcctggctcaagaagac
tttatgttttcctcggatgctagagatgactcaacagatggattccatgacatctgtgga
ccaaacaaggagctggatgaagagacctgtcagtgtgtctgcagagcggggcttcggcct
gtcagctgtggaccccacaaagaactagacagaaactcatgccagtgtgtctgtaaaaac
aaactcttccccagccaatgtggggccaaccgagaatttgatgaaaacacatgccagtgt
gtatgtaaaagaacctgccccagaaatcaacccctaaatcctggaaaatgtgcctgtgaa
tgtacagaaagtccacagaaatgcttgttaaaaggaaagaagttccaccaccaaacatgc
agctgttacagacggccatgtacgaaccgccagaaggcttgtgagccaggattttcatat
agtgaagaagtgtgtcgttgtgtcccttcatattggaaaagaccacaaatgagctaa

KEGG   Pongo abelii (Sumatran orangutan): 100453365
Entry
100453365         CDS       T01416                                 

Gene name
IGF2
Definition
(RefSeq) insulin-like growth factor II
  KO
K13769  insulin-like growth factor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04151  PI3K-Akt signaling pathway
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100453365 (IGF2)
   04014 Ras signaling pathway
    100453365 (IGF2)
   04151 PI3K-Akt signaling pathway
    100453365 (IGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100453365 (IGF2)
   05205 Proteoglycans in cancer
    100453365 (IGF2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100453365 (IGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100453365 (IGF2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100453365 (IGF2)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100453365 (IGF2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100453365 (IGF2)
SSDB
Motif
Pfam: IGF2_C Insulin
Other DBs
NCBI-GeneID: 100453365
NCBI-ProteinID: XP_024110663
Ensembl: ENSPPYG00000002922
LinkDB
Position
11
AA seq 236 aa
MVSPDPQIIVVAPETELASMQVQRTEDGVTIIQIFWVGRRGELLRRIPVSSAMQIPMGIP
MGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSR
GIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQ
RLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPTHGGTPPEMASNRK
NT seq 711 nt   +upstreamnt  +downstreamnt
atggtttccccagacccccaaattatcgtggtggcccccgagactgaactcgcgtctatg
caagtccaacgcactgaggacggggtaaccattatccagatattttgggtgggccgcaga
ggcgagctacttagacgcatcccggtgagctcggccatgcagataccaatgggaatccca
atggggaagtcgatgctggtgcttctcaccttcttggccttcgcctcgtgctgcattgct
gcttaccgccccagtgagaccctgtgcggcggggagctggtggacaccctccagttcgtc
tgtggggaccgcggcttctacttcagcaggcccgcaagccgtgtgagccgtcgcagccgt
ggcatcgttgaggagtgctgtttccgcagctgtgacctggccctcctggagacgtactgt
gctacccccgccaagtccgagagggacgtgtcgacccctccgaccgtgcttccggacaac
ttccccagataccccgtgggcaagttcttccaatatgacacctggaagcagtccacccag
cgcctgcgcaggggcctgcctgccctcctgcgtgcccgccggggtcacgtgctcgccaag
gagctcgaggcgttcagggaggccaagcgtcaccgtcccctgattgctctacccacccaa
gaccccacccacgggggcacccccccagagatggccagcaatcggaagtga

KEGG   Pongo abelii (Sumatran orangutan): 100453978
Entry
100453978         CDS       T01416                                 

Gene name
INS
Definition
(RefSeq) insulin isoform X1
  KO
K04526  insulin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04911  Insulin secretion
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04917  Prolactin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04940  Type I diabetes mellitus
pon04950  Maturity onset diabetes of the young
pon04960  Aldosterone-regulated sodium reabsorption
pon05010  Alzheimer disease
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100453978 (INS)
   04014 Ras signaling pathway
    100453978 (INS)
   04015 Rap1 signaling pathway
    100453978 (INS)
   04066 HIF-1 signaling pathway
    100453978 (INS)
   04068 FoxO signaling pathway
    100453978 (INS)
   04072 Phospholipase D signaling pathway
    100453978 (INS)
   04022 cGMP-PKG signaling pathway
    100453978 (INS)
   04151 PI3K-Akt signaling pathway
    100453978 (INS)
   04152 AMPK signaling pathway
    100453978 (INS)
   04150 mTOR signaling pathway
    100453978 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100453978 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100453978 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100453978 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100453978 (INS)
   04910 Insulin signaling pathway
    100453978 (INS)
   04923 Regulation of lipolysis in adipocytes
    100453978 (INS)
   04913 Ovarian steroidogenesis
    100453978 (INS)
   04914 Progesterone-mediated oocyte maturation
    100453978 (INS)
   04917 Prolactin signaling pathway
    100453978 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100453978 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    100453978 (INS)
   04213 Longevity regulating pathway - multiple species
    100453978 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    100453978 (INS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100453978 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100453978 (INS)
   04940 Type I diabetes mellitus
    100453978 (INS)
   04950 Maturity onset diabetes of the young
    100453978 (INS)
   04932 Non-alcoholic fatty liver disease
    100453978 (INS)
   04931 Insulin resistance
    100453978 (INS)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 100453978
NCBI-ProteinID: XP_024110664
LinkDB
Position
11
AA seq 203 aa
MALWMRLLPLLALLALWGPDPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQASALSPSSSTSTWPEGLDATARAPPALVATANIGQAGRSSSRQFRQRALGTSDSPVLF
IHCPGAAGTAQGLGYRGRRVTAELVWEEVDSSPQPQGSESLPAQPPAQPAPEPEPQQARV
AREPSPEVSCCGLWPRRPQRSQN
NT seq 612 nt   +upstreamnt  +downstreamnt
atggccctgtggatgcgcctcctgcccctgctggcgctgctggccctctggggacctgac
ccggcccaggcctttgtgaaccagcacctgtgcggctcccacctggtggaagctctctac
ctagtgtgcggggaacgaggcttcttctacacacccaagacccgccgggaggcagaggac
ctgcaggcctcagccttgtccccctcctcctccacatcaacctggccagagggtctggac
gccacagccagggcaccccctgctttggtggcgactgctaatattggccaggccggcaga
tcatcgtccaggcagtttcggcagagagccttgggcaccagtgactccccagtcctcttt
atccactgtccaggagctgcggggactgcgcagggactagggtacaggggccgaagagtc
accgccgagcttgtgtgggaggaggtggattccagcccccagccccagggctctgaatcg
ctgccagctcagccccctgcccagcctgccccagagcctgagccccagcaggccagagtg
gccagagagcccagtcctgaggtgagctgctgcggcctgtggcccaggcgaccccagcgc
tcccagaactga

KEGG   Pongo abelii (Sumatran orangutan): 100454475
Entry
100454475         CDS       T01416                                 

Gene name
FGF9
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100454475 (FGF9)
   04014 Ras signaling pathway
    100454475 (FGF9)
   04015 Rap1 signaling pathway
    100454475 (FGF9)
   04020 Calcium signaling pathway
    100454475 (FGF9)
   04151 PI3K-Akt signaling pathway
    100454475 (FGF9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100454475 (FGF9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454475 (FGF9)
  09162 Cancer: specific types
   05226 Gastric cancer
    100454475 (FGF9)
   05218 Melanoma
    100454475 (FGF9)
   05224 Breast cancer
    100454475 (FGF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100454475 (FGF9)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100454475 (FGF9)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100454475 (FGF9)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100454475 (FGF9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100454475
NCBI-ProteinID: XP_002824119
Ensembl: ENSPPYG00000005203
UniProt: H2NJD6 A0A663D593
LinkDB
Position
13
AA seq 208 aa
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccgtttggg
aatgtgcccgtgttgccggtggacagcccggttttgttaagtgaccacctgggtcagtcc
gaagcagggggtctccccaggggacccgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaatggt
actatccagggaaccaggaaagaccacagccgatttggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgaggcgtggacagcggactctacctcgggatgaatgag
aagggggagctatatggatcagaaaaactaacccaagagtgtgtattcagagaacagttc
gaagaaaactggtataatacgtactcatcaaacctatataagcacgtggacactggaagg
cgatactatgttgcattaaataaagatgggactccgagagaagggactaggactaaacgg
caccagaaattcacacattttttacctagaccagtggaccccgacaaagtacctgaactg
tataaggatattctaagccaaagttga

KEGG   Pongo abelii (Sumatran orangutan): 100454905
Entry
100454905         CDS       T01416                                 

Gene name
FGF16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100454905 (FGF16)
   04014 Ras signaling pathway
    100454905 (FGF16)
   04015 Rap1 signaling pathway
    100454905 (FGF16)
   04020 Calcium signaling pathway
    100454905 (FGF16)
   04151 PI3K-Akt signaling pathway
    100454905 (FGF16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100454905 (FGF16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454905 (FGF16)
  09162 Cancer: specific types
   05226 Gastric cancer
    100454905 (FGF16)
   05218 Melanoma
    100454905 (FGF16)
   05224 Breast cancer
    100454905 (FGF16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100454905 (FGF16)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100454905 (FGF16)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100454905 (FGF16)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100454905 (FGF16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100454905
NCBI-ProteinID: XP_002831878
Ensembl: ENSPPYG00000020490
UniProt: A0A6D2WUC7 H2PW31
LinkDB
Position
X
AA seq 207 aa
MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFHYR
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcagaggtggggggcgtcttcgcctccttggactgggatctacacggcttctcctca
tctctggggaacgtgcccttagctgactccccaggtttcctgaacgagcgcctgggccaa
atcgaggggaagctgcagcgtggctcacccacagacttcgcccacctgaaggggatcctg
cggcgccgccagctctactgccgcaccggcttccacctggagatcttccccaacggcacg
gtgcacggcacccgccacgaccacagccgcttcggaatcctggagtttatcagcctggct
gtggggctgatcagcatccggggagtggactctggcctgtacctaggaatgaatgagcga
ggagaactctatgggtcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa
gaaaactggtacaatacctatgcttcaaccttgtacaaacattcggactcggagagacag
tattacgtggccctgaacaaagatggctcaccccgggagggatacaggactaaacgacac
cagaaattcactcactttttacccaggcctgtagatccttctaagttgccctccatgtcc
agagacctctttcactataggtaa

KEGG   Pongo abelii (Sumatran orangutan): 100455021
Entry
100455021         CDS       T01416                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05160  Hepatitis C
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05226  Gastric cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100455021 (EGF)
   04012 ErbB signaling pathway
    100455021 (EGF)
   04014 Ras signaling pathway
    100455021 (EGF)
   04015 Rap1 signaling pathway
    100455021 (EGF)
   04630 JAK-STAT signaling pathway
    100455021 (EGF)
   04066 HIF-1 signaling pathway
    100455021 (EGF)
   04068 FoxO signaling pathway
    100455021 (EGF)
   04020 Calcium signaling pathway
    100455021 (EGF)
   04072 Phospholipase D signaling pathway
    100455021 (EGF)
   04151 PI3K-Akt signaling pathway
    100455021 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100455021 (EGF)
   04540 Gap junction
    100455021 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100455021 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100455021 (EGF)
   05231 Choline metabolism in cancer
    100455021 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100455021 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100455021 (EGF)
   05212 Pancreatic cancer
    100455021 (EGF)
   05226 Gastric cancer
    100455021 (EGF)
   05214 Glioma
    100455021 (EGF)
   05218 Melanoma
    100455021 (EGF)
   05219 Bladder cancer
    100455021 (EGF)
   05215 Prostate cancer
    100455021 (EGF)
   05213 Endometrial cancer
    100455021 (EGF)
   05224 Breast cancer
    100455021 (EGF)
   05223 Non-small cell lung cancer
    100455021 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100455021 (EGF)
   05165 Human papillomavirus infection
    100455021 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100455021 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100455021 (EGF)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100455021 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF cEGF EGF_CA DUF5050 EGF_3
Other DBs
NCBI-GeneID: 100455021
NCBI-ProteinID: XP_002815105
Ensembl: ENSPPYG00000014999
LinkDB
Position
4
AA seq 1208 aa
MLLTLIILLPVVLKFSFVSLSAPQHWSCPEGTLSGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYAQLVVDAGVSVIMDFHYNEKRIYWVDLERQFLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNHQEGIITVTDMKGNNSHVLLSALKYPANIAVDPVERFIFWSSEVAG
SLYRADLDGVEVRALLETSEKITAVSLDVLEKRLFWIQYNREGSNSLICSCDYDGGSVHI
NKHPTQHNLFAMSLFGDHIFYSTWKTKTIWIANKHTGKDMVRINLHSSFVPPGELKVVHP
LAQPKAEDDAWEPEQKLRKLRKGNCSSTVCGQDPQSHLCTCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPSNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCIPLSPVSWECDCFPGYDLQLDKKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGTVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIIMKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKEMLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDQKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
STYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYRGDGIHCLDIDECQLGVHSCGENANCTNTEGGYTCMCDGRLSEPGLICPDSTPPPHL
REDDHHYSVRNSDSGCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
ELRHAGHGQQRKVTVVAVCVVVLVVLLLLSLWGAHYYRTQKLLSKNSKNPYEESSRDVRS
RRPADTEDGMSSCPQPWFVVIKEHKDLRNGSQPVAGEDGQAADVGSVQPTSWRQEPQLCG
MGTEQGCWIPVSSDNGSCPQVMERSFHMPSYGTQPLEGGVEKPHSLLSANPLWQQRALDP
PHQMELTQ
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgctgctcactcttatcattctgttgccagtagttttaaaatttagttttgttagtctc
tcagcaccgcagcactggagctgtcctgaaggtactctctcaggaaatgggaattctact
tgtgtgggtcctgcacccttcttaattttctcccatggaaatagtatctttaggattgac
acagaaggaaccaattatgcgcaattggtggtggatgctggtgtctcagtgatcatggat
tttcattataatgagaaaagaatctattgggtggatttagaaagacaatttttgcaaaga
gtttttctgaacgggtcaaggcaagagagagtatgtaatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcatcaggaaggaatcatt
acagtaacagatatgaaaggaaataattcccacgttcttttaagtgctttaaaatatcct
gcaaatatagcagttgatccagtagaaaggtttatattttggtcttcagaggtggctgga
agcctttatagagcagatctcgatggtgtggaagtgagggctctgctggagacatcagag
aaaataacagctgtgtcattggatgtgcttgagaagcggctgttttggattcagtacaac
agagaaggaagcaattctcttatttgctcctgtgattatgatggaggttctgtccacatt
aataaacatccaacacagcacaatttgtttgcaatgtccctttttggtgaccatatcttc
tattcaacatggaaaacgaagacaatttggatagccaacaaacacactgggaaggacatg
gttagaattaacctccattcatcatttgtaccacctggtgaactgaaagtagtgcatcca
ctcgcacaacccaaggcagaagatgatgcttgggagcctgagcagaaacttcgcaaattg
aggaaaggaaactgcagcagcactgtgtgtgggcaagacccccagtcacacttgtgcacg
tgtgcagagggatacgccctaagtcgagaccggaagtactgtgaagatgttaatgaatgt
gctttttggaatcatggctgtactcttgggtgtaaaaacacccctggatcctattactgc
acatgccctgtaggatttgttctgcttcctgatgggaaacgatgtcatcaacttgtttcc
tgtccaagcaatgtgtctgaatgcagccatgactgtgttctgacatcagaaggtccctta
tgtttctgtcctgaaggctcggtgcttgagagagatgggaaaacatgtagcggttgttcc
tcacctgataatggtggatgtagccagctctgcattcctctcagcccagtatcctgggaa
tgtgattgctttcctgggtatgacctacaactggataaaaaaagctgtgcagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagactatggaactctgctcagccagcagatgggaacggtttatgccctagatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaaggagtagatgtgccagaaggtctt
gctgtggactggattggccgcagattctattggacagacagagggaaatctctgattgga
aggagtgatttaaatggaaaacgttccaaaataatcatgaaggagaacatctctcaacca
cgaggaattgctgttcatccaatggccaagagattattctggactgatacagggattaat
ccacgaattgaaagttcttccctccaaggccttggccgactggttatagccagctctgat
ctaatctggcccagtggaataacgattgacttcttaactgacaagttgtattggtgcgat
gccaagcagtctgtgattgaaatggccaatctggatggttcaaaacgccgaagacttacc
cagaatgatgtaggtcacccatttgctgtagccgtgtttgaggattatgtgtggttctca
gattgggctatgccatcagtaatgagagtaaacaagaggactggcaaagatagagtacgt
ctccaaggcagcatgctgaagccctcatcactggttgtggttcatccattggcaaaacca
ggagcagatccctgcttatatcaaaacggaggctgtgaacatatttgcaaagagatgctt
ggaactgcttggtgttcgtgtcgtgaaggttttatgaaagcctcagatgggaaaacgtgt
ctggctctggatggtcatcagctgttggcaggtggtgaagttgatcaaaagaaccaagta
acaccattggacatcttgtccaagactagagtgtcagaagataacattacagaatctcaa
cacatgctagtggctgaaatcatggtgtcagatcaagatgactgtgctcctgtgggatgc
agcacgtatgctcggtgtatttcagagggagaggatgccacatgtcagtgtttgaaagga
tttgctggggacggaaaactatgttctgatatagatgaatgtgagatgggtgtcccagtg
tgcccccctgcctcctccaagtgcatcaacaccgaagggggctatgtctgccggtgctca
gaaggctaccgaggagatgggattcactgtcttgatattgatgagtgccaactgggggtg
cacagctgtggagagaatgccaactgcacaaatacagagggaggctatacctgcatgtgt
gatggacgcctgtctgaaccaggactgatttgccctgactctactccaccccctcacctc
agggaagatgaccaccactattctgtaagaaatagtgactctggatgtcccctgtcccac
gatgggtactgcctccatgatggtgtgtgcatgtatattgaagcactggacaagtatgca
tgcaactgtgttgttggctacatcggggagcgatgtcagtaccgagacctgaagtggtgg
gaactgcgccacgctggccacgggcagcagcggaaggtcaccgtggtggctgtctgcgtg
gtggtgcttgtcgtgctgctcctcctgagcctgtggggggcccactactacaggactcag
aagctgctatcgaaaaattcaaagaatccttatgaggagtcgagcagagacgtgaggagt
cgcaggcctgctgacactgaggatgggatgtcctcttgccctcaaccttggtttgtggtt
ataaaggaacacaaagacctcaggaatgggagtcaaccagtggctggtgaggatggccag
gcagcagatgttgggtcagtgcaaccaacttcatggaggcaggagccccagttatgtgga
atgggcacagagcaaggctgctggattccagtatccagtgataacggctcctgtccccag
gtaatggagcgaagctttcatatgccctcctatgggacacagccccttgaagggggtgtt
gagaagccccattctctcctatcagctaacccattatggcaacaaagggccctggaccca
ccacaccaaatggagctgactcagtga

KEGG   Pongo abelii (Sumatran orangutan): 100456050
Entry
100456050         CDS       T01416                                 

Gene name
VEGFB
Definition
(RefSeq) vascular endothelial growth factor B isoform X2
  KO
K16858  vascular endothelial growth factor B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100456050 (VEGFB)
   04014 Ras signaling pathway
    100456050 (VEGFB)
   04015 Rap1 signaling pathway
    100456050 (VEGFB)
   04020 Calcium signaling pathway
    100456050 (VEGFB)
   04151 PI3K-Akt signaling pathway
    100456050 (VEGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100456050 (VEGFB)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100456050 (VEGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100456050 (VEGFB)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100456050 (VEGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100456050 (VEGFB)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100456050 (VEGFB)
SSDB
Motif
Pfam: PDGF VEGF_C CXCXC
Other DBs
NCBI-GeneID: 100456050
NCBI-ProteinID: XP_002821633
Ensembl: ENSPPYG00000003113
UniProt: A0A2J8TYH2
LinkDB
Position
11
AA seq 188 aa
MSPLLRRLLLAALLQLAPAQAPVSQPVVPGHQKKVVSWIDVYTRATCQPREVVVPLTVEL
MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS
QCECRPKKKDSAVKLDSPRPLCPRCTQRHQRPDPRTCRCRCRRRSFLRCQGRGLELNPDT
CRCRKLRR
NT seq 567 nt   +upstreamnt  +downstreamnt
atgagccctctgctccgccgcctgctgctcgccgcgctcctgcagctggcccccgcccag
gcccctgtctcccagcctgttgtccctggccaccagaagaaagtggtgtcatggatagat
gtgtatactcgtgctacctgccagccccgggaggtggtggtgcccctgactgtggagctc
atgggcaccgtggccaaacagctggtgcccagctgcgtgactgtgcagcgctgtggtggc
tgctgccctgacgatggcctggagtgtgtgcccactgggcagcaccaagtccggatgcag
atcctcatgatccggtacccgagcagtcagctgggggagatgtccctggaagaacacagc
cagtgtgaatgcagacctaaaaaaaaggacagtgctgtgaagctggacagccccaggccc
ctctgcccacgctgcacccagcgccaccagcgccctgacccccggacctgccgctgccgc
tgccgacgccgcagcttcctccgttgccaagggcggggcttagagctcaacccagacacc
tgcaggtgccggaagctgcgaaggtga

KEGG   Pongo abelii (Sumatran orangutan): 100457557
Entry
100457557         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: neurotrophin-4
  KO
K12457  neurotrophin 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100457557
   04014 Ras signaling pathway
    100457557
   04151 PI3K-Akt signaling pathway
    100457557
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100457557
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100457557
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100457557
SSDB
Motif
Pfam: NGF
Other DBs
NCBI-GeneID: 100457557
NCBI-ProteinID: XP_024093931
LinkDB
Position
19
AA seq 227 aa
MTSSSGGVRGLAFCAEKEGHMIGSLCIPLIFFLPSVSMEXLTPPLTLCPFPTPKWDLLXP
RVVLSRGAAAGPPLVFLLETGAFRESAGARANRSQPGVSETSPGSHRGELAMCDAVSGXV
TDPRTAVDLGVLKVEVLGEVPAAGGSSLRQHFFVTHFEADDSEEGGPGVGGGGCHQAVDR
GHWVSECKAKQSYVRALIADSQGPVDWRWIQIGTASVCTLLSRTGRA
NT seq 684 nt   +upstreamnt  +downstreamnt
atgacctccagctcaggaggtgtccggggtctcgccttctgtgcggagaaggaaggccac
atgatcggctccctctgcatccccctcattttcttcctccccagtgtgtcaatggagntc
ctaaccccacccttgacattgtgcccttttcctactccaaagtgggaccttcttntcccc
cgagtggtcctgtctaggggtgccgctgccgggccccctctggtcttcctgctggagact
ggggcctttagggagtcagcaggcgcccgggccaaccgcagccagcctggggtgagcgaa
acttcaccggggagtcatcggggtgagctggctatgtgcgatgcagtcagtggctgagtg
acagacccccggactgctgtggacttgggtgtgctcaaggtggaggtgttgggagaggtg
cctgcagctggcggcagttccctccgccagcacttctttgtcacccactttgaggccgat
gactctgaggaaggtggcccgggggtaggtggagggggctgccaccaggctgtggaccgg
gggcactgggtgtctgagtgcaaggccaagcagtcttatgtgcgggcattgatcgctgat
tcccagggccctgtggactggcgatggattcaaattggtactgccagtgtctgcacactc
ctcagccggactggccgggcctga

KEGG   Pongo abelii (Sumatran orangutan): 100459069
Entry
100459069         CDS       T01416                                 

Gene name
FGF6
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459069 (FGF6)
   04014 Ras signaling pathway
    100459069 (FGF6)
   04015 Rap1 signaling pathway
    100459069 (FGF6)
   04020 Calcium signaling pathway
    100459069 (FGF6)
   04151 PI3K-Akt signaling pathway
    100459069 (FGF6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459069 (FGF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459069 (FGF6)
  09162 Cancer: specific types
   05226 Gastric cancer
    100459069 (FGF6)
   05218 Melanoma
    100459069 (FGF6)
   05224 Breast cancer
    100459069 (FGF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100459069 (FGF6)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100459069 (FGF6)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100459069 (FGF6)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100459069 (FGF6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100459069
NCBI-ProteinID: XP_002822832
Ensembl: ENSPPYG00000004166
UniProt: A0A663DIP0 H2NG59
LinkDB
Position
12
AA seq 208 aa
MALGQRLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSLLEI
STVERGVVSLFGVRSALFIAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctgttcatcactatgtcccggggagcaggacgtctgcagggc
acgctgtgggctctcgtcttcctaggcatcctagtgggcatggtggtgccctcgcctgca
ggcacccgtgccaacaacacgctgctggactcgaggggctggggcaccctgctgtccagg
tctcgcgccgggctagctggagagattgccggggtgaactgggaaagtggctatttggtg
gggatcaagcggcagcggaggctttactgcaacgtgggcatcggctttcacctccaggtg
ctccccgacggccggatcagcgggacccacgaggagaacccctacagcctgctggaaatt
tccaccgtggagcgaggcgtggtgagtctctttggagtgagaagtgccctcttcattgcc
atgaacagtaaaggaagattgtacgcaacgcccagcttccaagaagaatgcaagttcaga
gaaaccctcctgcccaacaattacaatgcctatgagtcagacttgtaccgagggacctac
atcgccctgagcaaatacggacgggtaaagcggggcagcaaggtgtccccgatcatgact
gtcactcatttccttcccaggatataa

KEGG   Pongo abelii (Sumatran orangutan): 100459533
Entry
100459533         CDS       T01416                                 

Gene name
ANGPT2
Definition
(RefSeq) angiopoietin-2 isoform X2
  KO
K05466  angiopoietin 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459533 (ANGPT2)
   04014 Ras signaling pathway
    100459533 (ANGPT2)
   04015 Rap1 signaling pathway
    100459533 (ANGPT2)
   04066 HIF-1 signaling pathway
    100459533 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    100459533 (ANGPT2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100459533 (ANGPT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100459533 (ANGPT2)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100459533 (ANGPT2)
SSDB
Motif
Pfam: Fibrinogen_C DUF5713
Other DBs
NCBI-GeneID: 100459533
NCBI-ProteinID: XP_002818821
Ensembl: ENSPPYG00000018319
UniProt: H2PPF8 A0A6D2XQT4
LinkDB
Position
8
AA seq 495 aa
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
INKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVN
NSVLQKQQHDLMETVNNLLTMMSTSNSKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLT
FPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVS
QLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGN
DFSTKDADHDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSG
YSLKATTMLIRPADF
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgtggcagattgttttctttactctgagctgtgatcttgtcttggctgcagcctataac
aactttcggaagagcatggacagcataggaaagaagcaatatcaggtccagcatgggtcc
tgcagctacactttcctcctgccagagatggacaactgccgctcttcctccagcccctac
gtgtccaatgctgtgcagagggacgcgccgctcgaatacgatgactcggtgcagaggctg
caagtgctggagaacatcatggaaaacaacactcagtggctaatgaagcttgagaattat
atccaggacaacatgaaaaaagaaatggtagagatacagcagaatgcagtacagaaccag
acggctgtgatgatagaaatagggacaaacctgctgaaccaaacagcggagcaaacgcgg
aagttaactgatgtggaagcccaagtattaaatcagaccacgagacttgaacttcagctc
ttggaacactccctctcgacaaacaaattggaaaaacagattttggaccagaccagtgaa
ataaacaaattgcaagacaagaacagtttcctagaaaagaaggtgctagctatggaagac
aagcacatcatccaactacagtcaataaaagaagagaaagatcagctacaggtgttagta
tccaagcaaaattccatcattgaagagctagaaaaaaaaatagtgactgccacggtgaat
aattcagttcttcaaaagcagcaacatgatctcatggagacagttaataacttactgact
atgatgtccacatcaaactctaaggaccccactgttgctaaagaagaacaaatcagcttc
agagactgtgctgaagtattcaaatcaggacacaccacgaatggcatctacacgttaaca
ttccctaattctacagaagagatcaaggcctactgtgacatggaagctggcggaggcggg
tggacaattattcagcgacgtgaggatggcagcgttgattttcagaggacttggaaagaa
tataaagtgggatttggtaacccttcaggagaatattggctggggaatgagtttgtttcg
caactgactaatcagcaacgctacgtgcttaaaatacaccttaaagactgggaagggaat
gaggcttactcattgtatgaacatttctatctctcaagtgaagaactcaattataggatc
caccttaaaggacttacagggacagccggcaaaataagcagcatcagccaaccaggaaat
gattttagcacaaaggatgcagaccacgacaaatgtatttgcaaatgttcacaaatgcta
acaggaggctggtggtttgatgcatgtggtccttccaacttgaacggaatgtactatcca
caaaggcagaacacaaataagttcaacggcattaagtggtactactggaaaggctcaggc
tattcgctcaaggccacaaccatgctgatccgaccagcagatttctaa

KEGG   Pongo abelii (Sumatran orangutan): 100459690
Entry
100459690         CDS       T01416                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04640  Hematopoietic cell lineage
pon04916  Melanogenesis
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459690 (KITLG)
   04014 Ras signaling pathway
    100459690 (KITLG)
   04015 Rap1 signaling pathway
    100459690 (KITLG)
   04072 Phospholipase D signaling pathway
    100459690 (KITLG)
   04151 PI3K-Akt signaling pathway
    100459690 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100459690 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    100459690 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459690 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100459690 (KITLG)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100459690 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 100459690
NCBI-ProteinID: XP_002823612
LinkDB
Position
12
AA seq 273 aa
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSS
KDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKR
QPSLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattctcacttgcatttatcttcagctgctcctatttaat
cctctcgtcaaaactgaagggatctgcaggaatcgtgtgactaataatgtaaaagacgtc
actaaactggtggcaaatcttccaaaagactatatgataaccctcaaatatgtccccggg
atggatgttttgccgagtcattgttggataagtgagatggtagtacaattgtcagacagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattattccatc
atagacaaacttgtgaatatagtggatgaccttgtggagtgcgtgaaagaaaactcatct
aaggatctaaaaaaatcattcaagagcccagaacccaggctctttactcctgaagaattc
tttagaatttttaatagatccattgatgccttcaaggactttgtagtggcatcggaaact
agtgattgtgtggtttcttcaacattaagtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaggccaaaaatccccctggagactccagcctacactgggcagccatggcattg
ccagcattgttttctcttataattggctttgcttttggagccttatactggaagaagaga
cagccaagtcttacaagggcagttgaaaatatacaaattaatgaagaggataatgagata
agtatgttgcaagagaaagagagagagtttcaagaagtgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100459751
Entry
100459751         CDS       T01416                                 

Gene name
FGF2
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04810  Regulation of actin cytoskeleton
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459751 (FGF2)
   04014 Ras signaling pathway
    100459751 (FGF2)
   04015 Rap1 signaling pathway
    100459751 (FGF2)
   04020 Calcium signaling pathway
    100459751 (FGF2)
   04151 PI3K-Akt signaling pathway
    100459751 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100459751 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459751 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459751 (FGF2)
   05205 Proteoglycans in cancer
    100459751 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100459751 (FGF2)
   05218 Melanoma
    100459751 (FGF2)
   05224 Breast cancer
    100459751 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100459751 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100459751 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100459751 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100459751 (FGF2)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100459751 (FGF2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100459751 (FGF2)
SSDB
Motif
Pfam: FGF IL1 Fascin
Other DBs
NCBI-GeneID: 100459751
NCBI-ProteinID: XP_002815172
Ensembl: ENSPPYG00000015046
LinkDB
Position
4
AA seq 345 aa
MAMVASSHAWFMKVQRLVLLCDEQGNTGGEDLVSTTKEQSAPKGAARRREESWGHGRLVG
VGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPSSRAAGSP
RTRGRRTEERPSRSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAA
RGPRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVD
GVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESN
NYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggctatggttgcaagctctcatgcatggttcatgaaagtccagagactggttcttctt
tgtgacgagcagggcaacactggtggtgaggacttggtttccacaaccaaggagcagtct
gccccaaagggggcggcgcgcaggagggaggagagctgggggcacgggaggctggtgggt
gtcgggggtggagatgtagaagatgtgacgccgcggcccggcgggtgccagattagcgga
cgcggtgcccgcggttgcaacgggatcccgggcgctgcagcttgggaggcggctctcccc
aggcggcgtccgcggagacacccatccgtgaaccccagctcccgggccgccggctcgccg
cgcaccaggggccggcggacagaagagcggccgagccgctcgaggctgggggaccgcggg
cgcggccgcgcgctgccgggcgggaggctggggggccggggccggggccgtgccccggag
cgggtcggaggccggggccggggccgggggacggcggctccccgcgcggctccagcagct
cggggaccccggccgggccccgcagggaccatggcagccgggagcatcaccacgctgccc
gccttgcccgaggatggcggcagcggcgccttcccgcccggccacttcaaggaccccaag
cggctgtactgcaaaaacgggggcttcttcctgcgcatccaccccgacggccgagttgac
ggggtccgagagaagagcgaccctcacatcaaactacaacttcaagcagaagaaagagga
gttgtgtctatcaaaggagtgtgtgctaaccgctaccttgctatgaaggaagatggaaga
ttactggcttctaaatgtgttacggatgagtgtttcttttttgaacgattggaatctaat
aactacaatacttaccggtcaaggaaatacaccagttggtatgtggcactgaaacgaact
gggcagtataaacttggatccaaaacaggacctgggcagaaagctatactttttcttcca
atgtctgctaagagctga

KEGG   Pongo abelii (Sumatran orangutan): 100460243
Entry
100460243         CDS       T01416                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05231  Choline metabolism in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100460243 (PDGFB)
   04014 Ras signaling pathway
    100460243 (PDGFB)
   04015 Rap1 signaling pathway
    100460243 (PDGFB)
   04630 JAK-STAT signaling pathway
    100460243 (PDGFB)
   04020 Calcium signaling pathway
    100460243 (PDGFB)
   04072 Phospholipase D signaling pathway
    100460243 (PDGFB)
   04151 PI3K-Akt signaling pathway
    100460243 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100460243 (PDGFB)
   04540 Gap junction
    100460243 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460243 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460243 (PDGFB)
   05206 MicroRNAs in cancer
    100460243 (PDGFB)
   05231 Choline metabolism in cancer
    100460243 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    100460243 (PDGFB)
   05218 Melanoma
    100460243 (PDGFB)
   05211 Renal cell carcinoma
    100460243 (PDGFB)
   05215 Prostate cancer
    100460243 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100460243 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100460243 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100460243 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100460243 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100460243 (PDGFB)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100460243 (PDGFB)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100460243 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 100460243
NCBI-ProteinID: XP_002831201
Ensembl: ENSPPYG00000011836
UniProt: A0A6D2WYR8 H2P4F5
LinkDB
Position
22
AA seq 241 aa
MNRCWALFLYLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGDELESLARGRRSLGSLTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQDQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtatctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctctatgagatgctgagtgaccactcgatccgctcc
ttcgatgatctccagcgcctgctgcacggagaccccggagaggaagatggggccgagttg
gacctgaacatgacccgctcccactctggagacgagctggagagcttggctcgtggaaga
aggagcctgggttctctgaccgttgctgagccggccatgatcgctgagtgcaagacgcgc
accgaggtgttcgagatctcccggcgcctcatagaccgcaccaatgccaacttcctggtg
tggccgccctgcgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcgacctgtccaggtgagaaagatcgagattgtgcgg
aagaagccaatctttaagaaggccacggtgacgctggaggaccacctggcatgcaagtgt
gagacagtggcggctgcacggcctgtgacccgaagcccggggggttcccaggaccagcga
gccaaaacgccccaaactcgggtgaccattcggacggtgcgagtccgccggccccctaag
ggcaagcaccggaaattcaagcacacgcatgacaagacggcactgaaggagaccctcgga
gcctag

KEGG   Pongo abelii (Sumatran orangutan): 100460498
Entry
100460498         CDS       T01416                                 

Gene name
FGF18
Definition
(RefSeq) fibroblast growth factor 18
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100460498 (FGF18)
   04014 Ras signaling pathway
    100460498 (FGF18)
   04015 Rap1 signaling pathway
    100460498 (FGF18)
   04020 Calcium signaling pathway
    100460498 (FGF18)
   04151 PI3K-Akt signaling pathway
    100460498 (FGF18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460498 (FGF18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460498 (FGF18)
  09162 Cancer: specific types
   05226 Gastric cancer
    100460498 (FGF18)
   05218 Melanoma
    100460498 (FGF18)
   05224 Breast cancer
    100460498 (FGF18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100460498 (FGF18)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100460498 (FGF18)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100460498 (FGF18)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100460498 (FGF18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100460498
NCBI-ProteinID: XP_002816235
Ensembl: ENSPPYG00000016038
UniProt: H2PHC7 A0A663D7J4
LinkDB
Position
5
AA seq 207 aa
MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQPELQKPFKYTTVTKRSRRIRPTHPA
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtattcagcgccctccgcctgcacttgcctgtgtttacacttcctgctgctgtgcttc
caggtacaggtgctggttgccgaggagaacgtggacttccgcatccacgtggagaaccag
acgcgggctcgggacgatgtgagccgtaagcagctgcggctgtaccagctctacagccgg
accagtgggaaacacatccaggtcctgggccgcaggatcagtgcccgcggcgaggatggg
gacaagtatgcccagctcctagtggagacagacaccttcggtagtcaagtccggatcaag
ggcaaggagacggaattctacctgtgcatgaaccgcaaaggcaagctcgtggggaagccc
gatggcaccagcaaggagtgtgtgttcatcgagaaggttctggagaacaactacacggcc
ctgatgtcggctaagtactccggctggtacgtgggcttcaccaagaaggggcggccgcgg
aagggccccaagacccgggagaaccagcaggacgtgcatttcatgaagcgctaccccaag
gggcagccggagcttcagaagcccttcaagtacacgacggtgaccaagaggtcccgtcgg
atccggcccacacaccccgcctag

KEGG   Pongo abelii (Sumatran orangutan): 100460891
Entry
100460891         CDS       T01416                                 

Gene name
FGF20
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100460891 (FGF20)
   04014 Ras signaling pathway
    100460891 (FGF20)
   04015 Rap1 signaling pathway
    100460891 (FGF20)
   04020 Calcium signaling pathway
    100460891 (FGF20)
   04151 PI3K-Akt signaling pathway
    100460891 (FGF20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460891 (FGF20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460891 (FGF20)
  09162 Cancer: specific types
   05226 Gastric cancer
    100460891 (FGF20)
   05218 Melanoma
    100460891 (FGF20)
   05224 Breast cancer
    100460891 (FGF20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100460891 (FGF20)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100460891 (FGF20)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100460891 (FGF20)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100460891 (FGF20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100460891
NCBI-ProteinID: XP_002818879
Ensembl: ENSPPYG00000018382
UniProt: A0A6D2VSU8 A0A2J8X3S9
LinkDB
Position
8
AA seq 211 aa
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGAAERSARGGPGAAELAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcccttagccgaagtcgggggctttctgggcggcctagagggcttgggccagcag
gtgggttcgcatttcctgttgcctcctgccggggagcggccgccgctgctgggcgagcgc
aggggcgcggcggagcggagcgcccgcggcgggccgggggctgcggagctggcgcacctg
cacggcatcctgcgccgccggcagctctattgccgcaccggcttccacctgcagatcctg
cccgacggcagcgtgcagggcacccggcaggaccacagcctcttcggtatcttggaattc
atcagtgtggcagtgggactggtcagtattagaggtgtggacagtggtctctatcttgga
atgaatgacaaaggagaactctatggatcagagaaacttacttccgaatgcatctttagg
gagcagtttgaagagaactggtataacacctattcatctaacatatataaacatggagac
actggccgcaggtattttgtggcacttaacaaagacggaactccaagagatggcgccagg
tccaaaaggcatcagaaatttacacatttcttacctagaccagtggatccagaaagagtt
ccagaattgtacaaggacctactgatgtacacttga

KEGG   Pongo abelii (Sumatran orangutan): 100462115
Entry
100462115         CDS       T01416                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon05144  Malaria
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05211  Renal cell carcinoma
pon05218  Melanoma
pon05223  Non-small cell lung cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100462115 (HGF)
   04014 Ras signaling pathway
    100462115 (HGF)
   04015 Rap1 signaling pathway
    100462115 (HGF)
   04020 Calcium signaling pathway
    100462115 (HGF)
   04151 PI3K-Akt signaling pathway
    100462115 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100462115 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462115 (HGF)
   05205 Proteoglycans in cancer
    100462115 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100462115 (HGF)
   05226 Gastric cancer
    100462115 (HGF)
   05218 Melanoma
    100462115 (HGF)
   05211 Renal cell carcinoma
    100462115 (HGF)
   05223 Non-small cell lung cancer
    100462115 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    100462115 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100462115 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100462115 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100462115 (HGF)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100462115 (HGF)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100462115 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986
Other DBs
NCBI-GeneID: 100462115
NCBI-ProteinID: XP_002818342
Ensembl: ENSPPYG00000017860
UniProt: A0A6D2XN78 H2PN16
LinkDB
Position
7
AA seq 728 aa
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP
HRHKYLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL
ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHHMTPENFKCKDLRENYCRNPDGS
ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgtgggtgaccaaacttctgccagccctgctgctgcagcatgtcctcctgcatctcctc
ctgctccccatcgccatcccctatgcagagggacaaaggaaaagaagaaatacaattcat
gaattcaaaaagtcagcaaagactaccctaattaaaatagatccagcactgaagataaaa
accaaaaaagtgaatactgcagaccaatgtgctaatagatgtactaggaataaaggactt
ccattcacttgcaaggcttttgtttttgataaagcaagaaaacaatgcctctggttcccc
ttcaatagtatgtcaagtggagtgaaaaaagagtttggccatgaatttgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggacgcagctataagggaacagta
tctatcactaagagtggcatcaaatgtcagccctggagttccatgataccacacgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
cgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggggagagttatcga
ggtctcatggatcatacagaatcaggcaagatttgtcagcgctgggatcatcagacacca
caccggcacaaatacttgcctgaaagatatcccgacaagggctttgatgataattattgc
cgcaatcccgacggccagccgaggccatggtgctatactcttgaccctcacacccgctgg
gagtactgtgcaattaaaacatgcgctgacaatactatgaatgacactgatgttcctttg
gaaacaactgaatgcatccaaggtcaaggagaaggctacaggggcactgtcaataccatt
tggaatggaattccatgtcagcgttgggattctcagtatcctcacgagcatcacatgact
cctgaaaatttcaagtgcaaggacctacgagaaaattactgccgaaatccagatgggtct
gaatcaccctggtgttttaccactgatccaaacatccgagttggctactgctcccaaatt
ccaaactgtgatatgtcacatggacaagattgttatcgtgggaatggcaaaaattatatg
ggcaacttatcccaaacaagatctggactaacatgttcaatgtgggacaagaacatggaa
gacttacatcgtcatatcttctgggaaccagatgcaagtaagctgaatgagaattactgc
cgaaatccagatgatgatgctcatggaccctggtgctacacgggaaatccactcattcct
tgggattattgccctatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatcctgtaatatcttgtgccaaaacgaaacaattgcgagttgtaaatgggattcca
acacgaacaaacgtaggatggatggttagtttgagatacagaaataaacatatctgcgga
ggatcattgataaaggaaagttgggttcttactgcacgacagtgtttcccttctcgagac
ttgaaagattatgaagcttggcttggaattcatgatgtccacggaagaggagatgagaaa
tgcaaacaggttctcaatgtttcccagctggtatacggccctgaaggatcagatctggtt
ttaatgaagcttgccaggcctgctgtcctggatgattttgttagtacgattgatttacct
aattatggatgcacaattcctgaaaagaccagttgcagtgtttatggctggggctacact
ggattgatcaactatgatggtctgttacgagtggcacatctctatataatgggaaatgag
aaatgcagccagcatcatcgagggaaggtgactctgaatgagtctgaaatatgtgctggg
gctgaaaagattggatcaggaccatgtgagggggattatggtggcccacttgtttgtgag
caacataaaatgagaatggttcttggtgtcattgttcctggtcgtggatgtgccattcca
aatcgtcctggtatttttgtccgagtagcgtattatgcaaaatggattcacaaaattatt
ttaacatataaggtaccacagtcatag

KEGG   Pongo abelii (Sumatran orangutan): 103888645
Entry
103888645         CDS       T01416                                 

Gene name
NTF4
Definition
(RefSeq) neurotrophin-4
  KO
K12457  neurotrophin 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103888645 (NTF4)
   04014 Ras signaling pathway
    103888645 (NTF4)
   04151 PI3K-Akt signaling pathway
    103888645 (NTF4)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103888645 (NTF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    103888645 (NTF4)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   103888645 (NTF4)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 103888645
NCBI-ProteinID: XP_009231140
Ensembl: ENSPPYG00000010232
UniProt: H2NZL3
LinkDB
Position
19
AA seq 210 aa
MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLF
LLEAGAFRESAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEV
LGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWLSECKAKQSYVRAL
TADAQGRVGWRWIRIDTACVCTLLSRTGRA
NT seq 633 nt   +upstreamnt  +downstreamnt
atgctccctctcccctcatgctccctccccatcctcctccttttcctcctccccagtgtg
ccaattgagtcccaacccccaccctcaacattgcccccttttctggcccctgagtgggac
cttctgtccccccgagtagtcctgtctaggggtgcccctgctgggccccctctgctcttc
ctgctggaggctggggcctttcgggagtcagcaggtgccccggccaaccgcagccggcgt
ggggtgagcgaaactgcaccagcgagtcgtcggggtgagctggctgtgtgcgatgcagtc
agtggctgggtgacagaccgccggaccgctgtggacttgcgtgggcgcgaggtggaggtg
ttgggcgaggtgcctgcagctggcggcagtcccctccgccagtacttctttgaaacccgc
tgcaaggctgataatgctgaggaaggtggcccaggggcaggtggagggggctgccgggga
gtggacaggaggcactggttatctgagtgcaaggccaagcagtcctatgtgcgggcattg
accgctgatgcccagggccgtgtgggttggcgatggattcgaattgacactgcctgcgtc
tgcacactcctcagccggactggccgggcctga

KEGG   Pongo abelii (Sumatran orangutan): 112130075
Entry
112130075         CDS       T01416                                 

Gene name
EFNA2
Definition
(RefSeq) ephrin-A2
  KO
K05462  ephrin-A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112130075 (EFNA2)
   04014 Ras signaling pathway
    112130075 (EFNA2)
   04015 Rap1 signaling pathway
    112130075 (EFNA2)
   04151 PI3K-Akt signaling pathway
    112130075 (EFNA2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    112130075 (EFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112130075 (EFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    112130075 (EFNA2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    112130075 (EFNA2)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   112130075 (EFNA2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   112130075 (EFNA2)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 112130075
NCBI-ProteinID: XP_024092486
LinkDB
Position
19
AA seq 213 aa
MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYT
VEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP
GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEA
PEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS
NT seq 642 nt   +upstreamnt  +downstreamnt
atggcgcccgcgcagcgcccgctgctcccgctgctgctcctgctgttaccgctgccgccg
ccgcccttcgcgcgcgccgaggacgccgcccgcgccaactcggaccgctacgccgtctac
tggaaccgcagcaaccccaggttccacgcaggcgcaggggacgacggcgggggctacacg
gtggaggtgagcatcaatgactacctggacatctactgcccgcactatggggcgccgctg
ccgccggccgagcgcatggagcactacgtgctgtacatggtcaacggcgagggccacgcc
tcctgcgaccaccgccagcgcggcttcaagcgctgggagtgcaaccggcccgccgcgccc
ggggggccgctcaagttctcggagaagttccagctcttcacgcccttctccctgggcttc
gagttccggcccggccacgagtattactacatttctgccacgcctcccaatgctgttgac
cggccttgcctgcgactgaaggtgtatgtgcggccgaccaacgagaccctgtacgaggct
cctgagcccatcttcaccagcaataactcgtgtagcagcccgggcggctgccgcctcttc
ctcagcaccatccccgtgctctggaccctcctgggttcctag

DBGET integrated database retrieval system