KEGG   Pongo abelii (Sumatran orangutan): 100172539
Entry
100172539         CDS       T01416                                 

Gene name
FGF7
Definition
(RefSeq) fibroblast growth factor 7 precursor
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172539 (FGF7)
   04014 Ras signaling pathway
    100172539 (FGF7)
   04015 Rap1 signaling pathway
    100172539 (FGF7)
   04020 Calcium signaling pathway
    100172539 (FGF7)
   04151 PI3K-Akt signaling pathway
    100172539 (FGF7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100172539 (FGF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172539 (FGF7)
  09162 Cancer: specific types
   05226 Gastric cancer
    100172539 (FGF7)
   05218 Melanoma
    100172539 (FGF7)
   05224 Breast cancer
    100172539 (FGF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100172539 (FGF7)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100172539 (FGF7)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100172539 (FGF7)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100172539 (FGF7)
SSDB
Motif
Pfam: FGF Fascin Gb3_synth
Other DBs
NCBI-GeneID: 100172539
NCBI-ProteinID: NP_001125621
Ensembl: ENSPPYG00000006463
UniProt: Q5RAY8 A0A2J8VBG1
LinkDB
Position
15
AA seq 194 aa
MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcacaaatggatactgacatggatcctgccaactttgctctacagatcgtgctttcac
attatctgtctagtgggtactatatctttagcttgcaatgacatgactccagagcaaatg
gctacaaatgtgaactgttccagccctgagcgacacacaagaagttatgattacatggaa
ggaggggatataagagtgagaagactcttctgtcgaacacagtggtacctgaggattgat
aaaagaggcaaagtaaaagggacccaagagatgaagaataattacaatatcatggaaatc
aggacagtggcagttgggattgtggcaatcaaaggggtggaaagtgaattctatcttgca
atgaacaaggaaggaaaactctatgcaaagaaagaatgcaatgaagattgtaacttcaaa
gaactaattctggaaaaccattacaatacatatgcatcagctaaatggacacacaatgga
ggggaaatgtttgttgccttaaatcaaaaggggattcctgtaagaggaaaaaaaacaaag
aaagaacaaaaaacagcccactttcttcctatggcaataacttaa

KEGG   Pongo abelii (Sumatran orangutan): 100174103
Entry
100174103         CDS       T01416                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04390  Hippo signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100174103 (FGF1)
   04014 Ras signaling pathway
    100174103 (FGF1)
   04015 Rap1 signaling pathway
    100174103 (FGF1)
   04390 Hippo signaling pathway
    100174103 (FGF1)
   04020 Calcium signaling pathway
    100174103 (FGF1)
   04151 PI3K-Akt signaling pathway
    100174103 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100174103 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174103 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100174103 (FGF1)
   05218 Melanoma
    100174103 (FGF1)
   05224 Breast cancer
    100174103 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100174103 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100174103 (FGF1)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100174103 (FGF1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100174103 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100174103
NCBI-ProteinID: NP_001127073
UniProt: Q5NVQ3
LinkDB
Position
5
AA seq 214 aa
MHHAATLSPFLQCLPDTGRESGLEGAGISHLLKCWMQPLRFGRSRKLRLESATSSSCWAM
AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQL
SAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKN
WFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 645 nt   +upstreamnt  +downstreamnt
atgcaccatgctgccacattatctccattcctccagtgcctgcctgacactggccgtgaa
tcagggctggaaggggcaggcatttctcatttactaaagtgctggatgcagcccttgagg
ttcggcagaagcagaaagctgcgtcttgaaagcgccacaagcagcagctgctgggccatg
gctgaaggggaaatcaccaccttcacagccctgaccgagaagtttaatctgcctccaggg
aattacaagaagcccaaactcctctactgtagcaacgggggccacttcttgaggatcctt
ccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcagctc
agtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttggcc
atggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttcctg
gaaaggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaagaat
tggtttgttggcctcaagaagaatggaagctgcaaacgcggtcctcggactcactatggc
cagaaagcaatcttgtttctccccctgccagtctcttccgattaa

KEGG   Pongo abelii (Sumatran orangutan): 100431992
Entry
100431992         CDS       T01416                                 

Gene name
FGF10
Definition
(RefSeq) fibroblast growth factor 10
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100431992 (FGF10)
   04014 Ras signaling pathway
    100431992 (FGF10)
   04015 Rap1 signaling pathway
    100431992 (FGF10)
   04020 Calcium signaling pathway
    100431992 (FGF10)
   04151 PI3K-Akt signaling pathway
    100431992 (FGF10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100431992 (FGF10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431992 (FGF10)
  09162 Cancer: specific types
   05226 Gastric cancer
    100431992 (FGF10)
   05218 Melanoma
    100431992 (FGF10)
   05224 Breast cancer
    100431992 (FGF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100431992 (FGF10)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100431992 (FGF10)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100431992 (FGF10)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100431992 (FGF10)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100431992
NCBI-ProteinID: XP_002815587
Ensembl: ENSPPYG00000015444
UniProt: A0A6D2WTR6 H2PFH8
LinkDB
Position
5
AA seq 207 aa
MWKWILTHCASAFPHLPGCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSPS
SAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVV
AVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALN
GKGAPRRGQKTRRKNTSAHFLPMVVHS
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgcccggctgctgc
tgctgctttttgttgctgttcttggtgtcttccgtccctgtcacctgccaagcccttggt
caggacatggtgtcaccagaggccaccaactcttcttcctcctccttctcctctccttcc
agcgcgggaaggcatgtgcggagctacaatcaccttcaaggagatgtccgctggagaaag
ctattctctttcaccaagtactttctcaagattgagaagaacgggaaggtcagcgggacc
aagaaggagaactgcccgtacagcatcctggagataacatcagtagaaatcggagttgtt
gccgtcaaagccattaacagcaactattacttagccatgaacaagaaggggaaactctat
ggctcaaaagaatttaacaatgactgtaagctgaaggagaggatagaggaaaatggatac
aatacctatgcatcatttaactggcagcataatgggaggcaaatgtatgtggcattgaat
ggaaaaggagctccaaggagaggacagaaaacacgaaggaaaaacacctctgctcacttt
cttccaatggtggtacactcatag

KEGG   Pongo abelii (Sumatran orangutan): 100432789
Entry
100432789         CDS       T01416                                 

Gene name
FGF8
Definition
(RefSeq) fibroblast growth factor 8 isoform X1
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100432789 (FGF8)
   04014 Ras signaling pathway
    100432789 (FGF8)
   04015 Rap1 signaling pathway
    100432789 (FGF8)
   04020 Calcium signaling pathway
    100432789 (FGF8)
   04151 PI3K-Akt signaling pathway
    100432789 (FGF8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100432789 (FGF8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432789 (FGF8)
  09162 Cancer: specific types
   05226 Gastric cancer
    100432789 (FGF8)
   05218 Melanoma
    100432789 (FGF8)
   05224 Breast cancer
    100432789 (FGF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100432789 (FGF8)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100432789 (FGF8)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100432789 (FGF8)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100432789 (FGF8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100432789
NCBI-ProteinID: XP_024110054
LinkDB
Position
10
AA seq 244 aa
MGSPRSALSCLLLHLLVFCLQAQEGPGRGPALGREFASLFRAGREPQGVSQQVTVQSSPN
FTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETD
TFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYM
AFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWA
PEPR
NT seq 735 nt   +upstreamnt  +downstreamnt
atgggcagcccccgctccgcgctgagctgcctgctgttgcacttgctggtcttctgcctc
caagcccaggaaggcccgggcaggggccctgcgctgggcagggagttcgcttccctgttc
cgggctggccgggagccccagggtgtctcccaacaggtaactgttcagtcctcacctaat
tttacacagcatgtgagggagcagagcctggtgacggatcagctcagccgccgcctcatc
cggacctaccaactctacagccgcaccagcgggaagcacgtgcaggtcctggccaacaag
cgcatcaacgccatggcagaggacggcgaccccttcgcaaagctcatcgtggagacggac
acctttggaagcagagttcgagtccgaggagccgagacgggcctctacatctgcatgaac
aagaaggggaagctgatcgccaagagcaacggcaaaggcaaggactgcgtcttcacggag
attgtgctggagaacaactacacagcgctgcagaatgccaagtacgagggctggtacatg
gccttcacccgcaagggccggccccgcaagggctccaagacgcggcagcaccagcgtgag
gtccacttcatgaagcggctgccccggggccaccacaccaccgagcagagcctgcgcttc
gagttcctcaactacccgcccttcacgcgcagcctgcgcggcagccagaggacttgggcc
cccgagccccgatag

KEGG   Pongo abelii (Sumatran orangutan): 100437858
Entry
100437858         CDS       T01416                                 

Gene name
FGF5
Definition
(RefSeq) fibroblast growth factor 5 isoform X1
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100437858 (FGF5)
   04014 Ras signaling pathway
    100437858 (FGF5)
   04015 Rap1 signaling pathway
    100437858 (FGF5)
   04020 Calcium signaling pathway
    100437858 (FGF5)
   04151 PI3K-Akt signaling pathway
    100437858 (FGF5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100437858 (FGF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100437858 (FGF5)
  09162 Cancer: specific types
   05226 Gastric cancer
    100437858 (FGF5)
   05218 Melanoma
    100437858 (FGF5)
   05224 Breast cancer
    100437858 (FGF5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100437858 (FGF5)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100437858 (FGF5)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100437858 (FGF5)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100437858 (FGF5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100437858
NCBI-ProteinID: XP_002814964
Ensembl: ENSPPYG00000014880
UniProt: H2PDR2
LinkDB
Position
4
AA seq 268 aa
MSLSFLLLLFFTHLILSAWAHGEKCLAPKRQPGPAATDRNPRGSSSRQSSSSAMSSSSAS
SSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSI
LEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHR
TEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPP
SPIKPKVPLSAPRKNTNSVKYRLKFRFG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgagcttgtccttcctcctcctcctcttcttcacccacctgatcctcagcgcctgggct
cacggggagaagtgtctcgcccccaaacggcaacccggacccgctgccactgataggaac
cctagaggctccagcagcagacagagcagcagtagcgctatgtcttcctcttctgcctcc
tcctcccccgcagcttctctgggcagccaaggaagtggcttggagcagagcagtttccag
tggagcccctcggggcgccggaccggcagcctctactgcagagtgggcattggtttccat
ctgcagatctacccggatggcaaagtcaatggctcccacgaagccaatatgttaagtatt
ttggaaatatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaacaaa
tttttagcgatgtcaaaaaaaggaaaactccatgcaagtgccaagttcacagatgactgc
aagttcagggagcgttttcaagaaaacagctataatacctatgcctcagcaatacataga
actgaaaaaacagggcgggagtggtatgtggccctgaataaaagaggaaaagccaaacga
gggtgcagcccccgggttaaaccccagcacgtctctacgcattttctgccaagattcaag
cagtcggagcagccagaactttctttcacggttactgttcctgaaaagaaaaagccacct
agccctatcaagccaaaggttcccctttctgcacctcggaaaaataccaactcagtgaaa
tacagactcaagtttcgctttggataa

KEGG   Pongo abelii (Sumatran orangutan): 100439010
Entry
100439010         CDS       T01416                                 

Gene name
FGF23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon04928  Parathyroid hormone synthesis, secretion and action
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100439010 (FGF23)
   04014 Ras signaling pathway
    100439010 (FGF23)
   04015 Rap1 signaling pathway
    100439010 (FGF23)
   04020 Calcium signaling pathway
    100439010 (FGF23)
   04151 PI3K-Akt signaling pathway
    100439010 (FGF23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100439010 (FGF23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100439010 (FGF23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100439010 (FGF23)
  09162 Cancer: specific types
   05226 Gastric cancer
    100439010 (FGF23)
   05218 Melanoma
    100439010 (FGF23)
   05224 Breast cancer
    100439010 (FGF23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100439010 (FGF23)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100439010 (FGF23)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100439010 (FGF23)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100439010 (FGF23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100439010
NCBI-ProteinID: XP_024113051
LinkDB
Position
12
AA seq 251 aa
MLGARLRLWVCALCSVCSVSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFNPENCRFQQQTL
ENGYDVYHSPQHHFLVSLGRVKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPVPRRHTRS
AEDDSERDPLKVLKPRARMTPAPASCSQELPSSEDNSPMASDPLGVVRGGRVNTHAGGTG
PEGCRPFPKFI
NT seq 756 nt   +upstreamnt  +downstreamnt
atgttgggggcccgcctcaggctctgggtctgtgccttgtgcagcgtctgcagcgtgagc
gtcctcagagcctatcccaatgcctccccactgctcggctccagctggggtggcctgatc
cacctgtacacagccacagccaggaacagctaccacctgcagatccacaagaatggccat
gtggatggcgcaccccatcagaccatctacagtgccctgatgatcagatcagaggatgct
ggctttgtggtgattacaggtgtgatgagcagaagatacctctgcatggatttcagaggc
aacatttttggatcacactatttcaacccagagaactgcaggttccaacagcagacgctg
gaaaacgggtatgacgtctaccactctcctcagcatcactttctggtcagtctgggccgg
gtgaagagagccttcctgccaggcatgaacccacccccgtactcccagttcctgtcccgg
aggaacgagatccccctaattcacttcaacacccccgtaccacgacggcacacccggagc
gccgaggatgactcggagcgggaccccctgaaagtgctgaagccccgggcccggatgacc
ccggccccggcctcctgctcacaggagctcccgagctccgaggacaacagcccgatggcc
agcgacccattaggggtggtcaggggcggtcgagtgaacacgcacgctgggggaacgggc
ccggaaggctgccgccccttccccaagttcatctag

KEGG   Pongo abelii (Sumatran orangutan): 100440363
Entry
100440363         CDS       T01416                                 

Gene name
FGF3
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100440363 (FGF3)
   04014 Ras signaling pathway
    100440363 (FGF3)
   04015 Rap1 signaling pathway
    100440363 (FGF3)
   04020 Calcium signaling pathway
    100440363 (FGF3)
   04151 PI3K-Akt signaling pathway
    100440363 (FGF3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100440363 (FGF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440363 (FGF3)
  09162 Cancer: specific types
   05226 Gastric cancer
    100440363 (FGF3)
   05218 Melanoma
    100440363 (FGF3)
   05224 Breast cancer
    100440363 (FGF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100440363 (FGF3)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100440363 (FGF3)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100440363 (FGF3)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100440363 (FGF3)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100440363
NCBI-ProteinID: XP_002821457
Ensembl: ENSPPYG00000002957
UniProt: H2NCJ6 A0A6D2XD77
LinkDB
Position
11
AA seq 239 aa
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER
IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHRDHEMVRQLQGGLPRPPGKGVQPRRRRQKQSPDSLEPSYVQAPRLGSQLEASAH
NT seq 720 nt   +upstreamnt  +downstreamnt
atgggcctaatctggctgctgctgctcagcctgctggagcccggctggcccgcagcgggc
cctggggcgcggttgcggcgcgatgcgggcggccgtggcggcgtctacgagcaccttggc
ggggcgccccggcgccgcaagctctactgcgccacgaagtaccacctccagctgcacccg
agcggccgcgtcaacggcagcctggagaacagcgcctacagtattctggagataacggca
gtggaggtgggcattgtggccatcaggggtctcttctccgggcggtacctggccatgaac
aagaggggacgactctatgcttcggagcactacagcgccgagtgcgagtttgtggagcgg
atccacgagctgggctataacacgtatgcctcccggctgtaccggacggtgtctagtacg
cctggggcccggcggcagcccagcgccgagagactgtggtacgtgtctgtgaacggcaag
ggccggccccgcaggggcttcaagacccgccgcacacagaagtcctccctgttcttgccc
cgcgtgctggaccacagggaccatgagatggtgcggcagctgcagggtgggctgcccaga
ccccctggtaagggggtccagccccgacggcggcggcagaagcagagcccggatagcctg
gagccctcgtacgttcaggccccgagactgggctcccagctggaggccagtgcgcactag

KEGG   Pongo abelii (Sumatran orangutan): 100440732
Entry
100440732         CDS       T01416                                 

Gene name
FGF4
Definition
(RefSeq) fibroblast growth factor 4
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100440732 (FGF4)
   04014 Ras signaling pathway
    100440732 (FGF4)
   04015 Rap1 signaling pathway
    100440732 (FGF4)
   04020 Calcium signaling pathway
    100440732 (FGF4)
   04151 PI3K-Akt signaling pathway
    100440732 (FGF4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100440732 (FGF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440732 (FGF4)
  09162 Cancer: specific types
   05226 Gastric cancer
    100440732 (FGF4)
   05218 Melanoma
    100440732 (FGF4)
   05224 Breast cancer
    100440732 (FGF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100440732 (FGF4)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100440732 (FGF4)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100440732 (FGF4)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100440732 (FGF4)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100440732
NCBI-ProteinID: XP_002821458
Ensembl: ENSPPYG00000002958
UniProt: H2NCJ7 A0A663D9Z2
LinkDB
Position
11
AA seq 206 aa
MSGPGTAAAALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVARSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
VERGVVSIFGVASRFFVAMSSRGKLYGSPFFTDECKFKEILLPNNYNAYESYKYPGMFIA
LSKNGKTKKGNRVSPTMKVTHFLPRL
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtcggggcccgggacggccgcggcagcgctgctcccggcggtcctgctggccttgctg
gcgccctgggcgggccgagggggcgccgccgcacccactgcacccaacggcacgctggag
gccgagctggagcgccgctgggagagcctggtggcgcgctcgttggcgcgcctgccggtg
gcagcgcaacccaaggaggcggccgtccagagcggcgccggcgactacctgctgggcatc
aagcggctgcggcggctctactgcaacgtgggcatcggcttccacctccaggcgctcccc
gacggccgcatcggcggcgcgcacgcggacacccgcgacagcctgctggagctctcgccc
gtggagcggggcgtggtgagcatcttcggcgtggccagccggttcttcgtggccatgagc
agcaggggcaagctctatggctcgcccttcttcaccgatgagtgcaagttcaaggagatt
ctcctccccaacaactacaacgcctacgagtcctacaagtaccccggcatgttcatcgcc
ctaagcaagaatgggaagaccaagaaggggaaccgagtgtcgcccactatgaaggtcacc
cacttcctccccaggctgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100441475
Entry
100441475         CDS       T01416                                 

Gene name
FGF19
Definition
(RefSeq) fibroblast growth factor 19
  KO
K22603  fibroblast growth factor 19
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100441475 (FGF19)
   04014 Ras signaling pathway
    100441475 (FGF19)
   04015 Rap1 signaling pathway
    100441475 (FGF19)
   04020 Calcium signaling pathway
    100441475 (FGF19)
   04151 PI3K-Akt signaling pathway
    100441475 (FGF19)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100441475 (FGF19)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100441475 (FGF19)
  09162 Cancer: specific types
   05226 Gastric cancer
    100441475 (FGF19)
   05218 Melanoma
    100441475 (FGF19)
   05224 Breast cancer
    100441475 (FGF19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100441475 (FGF19)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100441475 (FGF19)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100441475 (FGF19)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100441475 (FGF19)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100441475
NCBI-ProteinID: XP_002821459
Ensembl: ENSPPYG00000002960
UniProt: A0A663D5M7 H2NCJ9
LinkDB
Position
11
AA seq 216 aa
MRSGCVVVHAWILAGLWLAVAGRPLAFSDSGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLR
RHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
NT seq 651 nt   +upstreamnt  +downstreamnt
atgcggagcgggtgtgtggtggtccacgcctggatcctggccggcctctggctggccgtg
gccgggcgccccctcgccttctcggactcggggccccacgtgcactacggctggggcgac
cccatccgcctgcggcacctgtacacctccggcccccacgggctctccagctgcttcctg
cgcatccgtgccgacggcgtcgtggactgcgcgcggggccagagcgcgcacagtttgctg
gagatcaaggcagtcgctctgcggaccgtggccatcaagggcgtgcacagcgtgcggtac
ctctgcatgggcgccgacggcaagatgcaggggctgcttcagtactcggaggaagactgt
gctttcgaggaggagatccgcccagatggctacaatgtgtaccgatccgagaagcaccgc
ctcccggtctccctgagcagtgccaaacagcggcagctgtacaagaacaggggctttctt
ccgctctctcatttcctgcccatgctgcccatggtcccagaggagcctgaggacctcagg
cgccacttggaatccgacatgttctcttcgcccctggagaccgacagcatggacccattt
gggcttgtcaccggactggaggccgtgaggagtcccagctttgagaaataa

KEGG   Pongo abelii (Sumatran orangutan): 100447289
Entry
100447289         CDS       T01416                                 

Gene name
FGF21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04714  Thermogenesis
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100447289 (FGF21)
   04014 Ras signaling pathway
    100447289 (FGF21)
   04015 Rap1 signaling pathway
    100447289 (FGF21)
   04020 Calcium signaling pathway
    100447289 (FGF21)
   04151 PI3K-Akt signaling pathway
    100447289 (FGF21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100447289 (FGF21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100447289 (FGF21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447289 (FGF21)
  09162 Cancer: specific types
   05226 Gastric cancer
    100447289 (FGF21)
   05218 Melanoma
    100447289 (FGF21)
   05224 Breast cancer
    100447289 (FGF21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100447289 (FGF21)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100447289 (FGF21)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100447289 (FGF21)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100447289 (FGF21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100447289
NCBI-ProteinID: XP_002829565
Ensembl: ENSPPYG00000010214
UniProt: A0A6D2W2N6 A0A2J8U7P8
LinkDB
Position
19
AA seq 209 aa
MDSDETGFEHSGLWVPVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAH
LEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGI
LAPQPPDVGSSDPLSMVGPSQGRSPSYAS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggactcggacgagaccgggttcgagcactcaggactgtgggttcctgtgctggctggt
cttctgctgggagcctgccaggcacaccccatccctgactccagtcctctcctgcaattc
gggggccaagtccggcagcggtacctctacacagatgatgcccagcagacagaagcccac
ctggagatcagggaggatgggacggtggggggcgctgctgaccagagccccgaaagtctc
ctgcagctgaaagccttgaagccgggagttattcaaatcttgggagtcaagacatccagg
ttcctgtgccagaggccagatggggccctgtatggatcgctccactttgaccctgaggcc
tgcagcttccgggagctgcttcttgaggacggatacaatgtttatcagtccgaggcccat
ggcctcccgctgcatctgccgggaaacaagtccccacaccgggaccctgcaccccgagga
ccagctcgcttcctgccactaccaggcctgccccccgcacccccagagccgcccggaatc
ctggccccccagccccccgatgtgggctcctcggaccctctgagcatggtgggaccttcc
cagggccgaagccccagctatgcttcctga

KEGG   Pongo abelii (Sumatran orangutan): 100448388
Entry
100448388         CDS       T01416                                 

Gene name
FGF22
Definition
(RefSeq) fibroblast growth factor 22 isoform X1
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100448388 (FGF22)
   04014 Ras signaling pathway
    100448388 (FGF22)
   04015 Rap1 signaling pathway
    100448388 (FGF22)
   04020 Calcium signaling pathway
    100448388 (FGF22)
   04151 PI3K-Akt signaling pathway
    100448388 (FGF22)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100448388 (FGF22)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100448388 (FGF22)
  09162 Cancer: specific types
   05226 Gastric cancer
    100448388 (FGF22)
   05218 Melanoma
    100448388 (FGF22)
   05224 Breast cancer
    100448388 (FGF22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100448388 (FGF22)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100448388 (FGF22)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100448388 (FGF22)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100448388 (FGF22)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100448388
NCBI-ProteinID: XP_024093684
LinkDB
Position
19
AA seq 192 aa
MRRRLWLGLAWLLLAPAPDAAGTPSALRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGR
VQGTRWRHGQDSILEIRSVRVGVVVIKAVSSGFYVAMNRRGRLYGSVPGAHRRDRPQHLR
LTVLAPPRPAHVPGTGQAGGAPARRPDAAVPPVRPLPARPGLLRPREAGGFPRCLGWWRG
ARPRLFFPLLAP
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcgccgccgcctgtggctgggcctggcctggctgctgctggcgccggcgccggacgcc
gcgggaaccccgagcgcgctgcggggaccgcgcagctacccgcacctggagggcgacgtg
cgctggcggcgcctcttctcctccactcacttcttcctgcgcgtggatcccggcggccgc
gtgcagggcacccgctggcgccacggccaggacagtatcctggagatccgctctgtacgc
gtgggcgtcgtggtcatcaaagcagtgtcctcaggcttctacgtggccatgaaccgccgg
ggccgcctctacgggtcggttccgggagcgcatcgaagagaccggccacaacacctacgc
ctcacagtgctggcgccgccacggccagcccatgttcctggcactggacaggcagggggg
gccccggccaggcggccggacgcggcggtaccacctgtccgcccacttcctgcccgtcct
ggtctcctgaggccccgagaggccggcggcttcccaaggtgcctgggctggtggcgaggg
gcccggccacgcttgttcttccccttgctggctccctaa

KEGG   Pongo abelii (Sumatran orangutan): 100450364
Entry
100450364         CDS       T01416                                 

Gene name
FGF17
Definition
(RefSeq) fibroblast growth factor 17 isoform X2
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100450364 (FGF17)
   04014 Ras signaling pathway
    100450364 (FGF17)
   04015 Rap1 signaling pathway
    100450364 (FGF17)
   04020 Calcium signaling pathway
    100450364 (FGF17)
   04151 PI3K-Akt signaling pathway
    100450364 (FGF17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100450364 (FGF17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450364 (FGF17)
  09162 Cancer: specific types
   05226 Gastric cancer
    100450364 (FGF17)
   05218 Melanoma
    100450364 (FGF17)
   05224 Breast cancer
    100450364 (FGF17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100450364 (FGF17)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100450364 (FGF17)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100450364 (FGF17)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100450364 (FGF17)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 100450364
NCBI-ProteinID: XP_002818910
Ensembl: ENSPPYG00000018409
UniProt: A0A2J8X4E0
LinkDB
Position
8
AA seq 205 aa
MGAARLLPNLTLCLQLLILCCQTQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGR
RISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTE
IVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEK
QKQFEFVGSAPTRRTKRTRRPQPLT
NT seq 618 nt   +upstreamnt  +downstreamnt
atgggagccgcccgcctgctgcccaacctcactctgtgcttacagctgctgattctctgc
tgtcaaactcagtacgtgagggaccagggcgccatgaccgaccagctgagcaggcggcag
atccgtgagtaccaactctacagccggaccagtggcaagcacgtgcaggtcaccgggcgt
cgcatctccgccaccgcagaggacggcaacaagtttgccaagctcatagtggagacggac
acgtttggcagccgggttcgcatcaaaggggctgagagcgagaagtacatctgtatgaac
aagaggggcaagctcatcgggaagcccagcgggaagagcaaagactgcgtgttcacggag
atcgtgctggagaacaactacacggccttccagaacgcccggcacgagggctggttcatg
gccttcacgcggcaggggcggccccgccaggcttcccgcagccgccagaaccagcgcgag
gcccacttcatcaagcgcctctaccaaggccagctgcccttccccaaccacgccgagaag
cagaagcagttcgagtttgtgggctccgcccccacccgccggaccaagcgcacgcggcgg
ccccagcccctcacgtag

KEGG   Pongo abelii (Sumatran orangutan): 100454475
Entry
100454475         CDS       T01416                                 

Gene name
FGF9
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100454475 (FGF9)
   04014 Ras signaling pathway
    100454475 (FGF9)
   04015 Rap1 signaling pathway
    100454475 (FGF9)
   04020 Calcium signaling pathway
    100454475 (FGF9)
   04151 PI3K-Akt signaling pathway
    100454475 (FGF9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100454475 (FGF9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454475 (FGF9)
  09162 Cancer: specific types
   05226 Gastric cancer
    100454475 (FGF9)
   05218 Melanoma
    100454475 (FGF9)
   05224 Breast cancer
    100454475 (FGF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100454475 (FGF9)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100454475 (FGF9)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100454475 (FGF9)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100454475 (FGF9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100454475
NCBI-ProteinID: XP_002824119
Ensembl: ENSPPYG00000005203
UniProt: H2NJD6 A0A663D593
LinkDB
Position
13
AA seq 208 aa
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccgtttggg
aatgtgcccgtgttgccggtggacagcccggttttgttaagtgaccacctgggtcagtcc
gaagcagggggtctccccaggggacccgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaatggt
actatccagggaaccaggaaagaccacagccgatttggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgaggcgtggacagcggactctacctcgggatgaatgag
aagggggagctatatggatcagaaaaactaacccaagagtgtgtattcagagaacagttc
gaagaaaactggtataatacgtactcatcaaacctatataagcacgtggacactggaagg
cgatactatgttgcattaaataaagatgggactccgagagaagggactaggactaaacgg
caccagaaattcacacattttttacctagaccagtggaccccgacaaagtacctgaactg
tataaggatattctaagccaaagttga

KEGG   Pongo abelii (Sumatran orangutan): 100454905
Entry
100454905         CDS       T01416                                 

Gene name
FGF16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100454905 (FGF16)
   04014 Ras signaling pathway
    100454905 (FGF16)
   04015 Rap1 signaling pathway
    100454905 (FGF16)
   04020 Calcium signaling pathway
    100454905 (FGF16)
   04151 PI3K-Akt signaling pathway
    100454905 (FGF16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100454905 (FGF16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454905 (FGF16)
  09162 Cancer: specific types
   05226 Gastric cancer
    100454905 (FGF16)
   05218 Melanoma
    100454905 (FGF16)
   05224 Breast cancer
    100454905 (FGF16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100454905 (FGF16)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100454905 (FGF16)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100454905 (FGF16)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100454905 (FGF16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100454905
NCBI-ProteinID: XP_002831878
Ensembl: ENSPPYG00000020490
UniProt: A0A6D2WUC7 H2PW31
LinkDB
Position
X
AA seq 207 aa
MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFHYR
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcagaggtggggggcgtcttcgcctccttggactgggatctacacggcttctcctca
tctctggggaacgtgcccttagctgactccccaggtttcctgaacgagcgcctgggccaa
atcgaggggaagctgcagcgtggctcacccacagacttcgcccacctgaaggggatcctg
cggcgccgccagctctactgccgcaccggcttccacctggagatcttccccaacggcacg
gtgcacggcacccgccacgaccacagccgcttcggaatcctggagtttatcagcctggct
gtggggctgatcagcatccggggagtggactctggcctgtacctaggaatgaatgagcga
ggagaactctatgggtcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa
gaaaactggtacaatacctatgcttcaaccttgtacaaacattcggactcggagagacag
tattacgtggccctgaacaaagatggctcaccccgggagggatacaggactaaacgacac
cagaaattcactcactttttacccaggcctgtagatccttctaagttgccctccatgtcc
agagacctctttcactataggtaa

KEGG   Pongo abelii (Sumatran orangutan): 100459069
Entry
100459069         CDS       T01416                                 

Gene name
FGF6
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459069 (FGF6)
   04014 Ras signaling pathway
    100459069 (FGF6)
   04015 Rap1 signaling pathway
    100459069 (FGF6)
   04020 Calcium signaling pathway
    100459069 (FGF6)
   04151 PI3K-Akt signaling pathway
    100459069 (FGF6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459069 (FGF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459069 (FGF6)
  09162 Cancer: specific types
   05226 Gastric cancer
    100459069 (FGF6)
   05218 Melanoma
    100459069 (FGF6)
   05224 Breast cancer
    100459069 (FGF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100459069 (FGF6)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100459069 (FGF6)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100459069 (FGF6)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100459069 (FGF6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100459069
NCBI-ProteinID: XP_002822832
Ensembl: ENSPPYG00000004166
UniProt: A0A663DIP0 H2NG59
LinkDB
Position
12
AA seq 208 aa
MALGQRLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSLLEI
STVERGVVSLFGVRSALFIAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctgttcatcactatgtcccggggagcaggacgtctgcagggc
acgctgtgggctctcgtcttcctaggcatcctagtgggcatggtggtgccctcgcctgca
ggcacccgtgccaacaacacgctgctggactcgaggggctggggcaccctgctgtccagg
tctcgcgccgggctagctggagagattgccggggtgaactgggaaagtggctatttggtg
gggatcaagcggcagcggaggctttactgcaacgtgggcatcggctttcacctccaggtg
ctccccgacggccggatcagcgggacccacgaggagaacccctacagcctgctggaaatt
tccaccgtggagcgaggcgtggtgagtctctttggagtgagaagtgccctcttcattgcc
atgaacagtaaaggaagattgtacgcaacgcccagcttccaagaagaatgcaagttcaga
gaaaccctcctgcccaacaattacaatgcctatgagtcagacttgtaccgagggacctac
atcgccctgagcaaatacggacgggtaaagcggggcagcaaggtgtccccgatcatgact
gtcactcatttccttcccaggatataa

KEGG   Pongo abelii (Sumatran orangutan): 100459751
Entry
100459751         CDS       T01416                                 

Gene name
FGF2
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04810  Regulation of actin cytoskeleton
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459751 (FGF2)
   04014 Ras signaling pathway
    100459751 (FGF2)
   04015 Rap1 signaling pathway
    100459751 (FGF2)
   04020 Calcium signaling pathway
    100459751 (FGF2)
   04151 PI3K-Akt signaling pathway
    100459751 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100459751 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459751 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459751 (FGF2)
   05205 Proteoglycans in cancer
    100459751 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100459751 (FGF2)
   05218 Melanoma
    100459751 (FGF2)
   05224 Breast cancer
    100459751 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100459751 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100459751 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100459751 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100459751 (FGF2)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100459751 (FGF2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100459751 (FGF2)
SSDB
Motif
Pfam: FGF IL1 Fascin
Other DBs
NCBI-GeneID: 100459751
NCBI-ProteinID: XP_002815172
Ensembl: ENSPPYG00000015046
LinkDB
Position
4
AA seq 345 aa
MAMVASSHAWFMKVQRLVLLCDEQGNTGGEDLVSTTKEQSAPKGAARRREESWGHGRLVG
VGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPSSRAAGSP
RTRGRRTEERPSRSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAA
RGPRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVD
GVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESN
NYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggctatggttgcaagctctcatgcatggttcatgaaagtccagagactggttcttctt
tgtgacgagcagggcaacactggtggtgaggacttggtttccacaaccaaggagcagtct
gccccaaagggggcggcgcgcaggagggaggagagctgggggcacgggaggctggtgggt
gtcgggggtggagatgtagaagatgtgacgccgcggcccggcgggtgccagattagcgga
cgcggtgcccgcggttgcaacgggatcccgggcgctgcagcttgggaggcggctctcccc
aggcggcgtccgcggagacacccatccgtgaaccccagctcccgggccgccggctcgccg
cgcaccaggggccggcggacagaagagcggccgagccgctcgaggctgggggaccgcggg
cgcggccgcgcgctgccgggcgggaggctggggggccggggccggggccgtgccccggag
cgggtcggaggccggggccggggccgggggacggcggctccccgcgcggctccagcagct
cggggaccccggccgggccccgcagggaccatggcagccgggagcatcaccacgctgccc
gccttgcccgaggatggcggcagcggcgccttcccgcccggccacttcaaggaccccaag
cggctgtactgcaaaaacgggggcttcttcctgcgcatccaccccgacggccgagttgac
ggggtccgagagaagagcgaccctcacatcaaactacaacttcaagcagaagaaagagga
gttgtgtctatcaaaggagtgtgtgctaaccgctaccttgctatgaaggaagatggaaga
ttactggcttctaaatgtgttacggatgagtgtttcttttttgaacgattggaatctaat
aactacaatacttaccggtcaaggaaatacaccagttggtatgtggcactgaaacgaact
gggcagtataaacttggatccaaaacaggacctgggcagaaagctatactttttcttcca
atgtctgctaagagctga

KEGG   Pongo abelii (Sumatran orangutan): 100460498
Entry
100460498         CDS       T01416                                 

Gene name
FGF18
Definition
(RefSeq) fibroblast growth factor 18
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100460498 (FGF18)
   04014 Ras signaling pathway
    100460498 (FGF18)
   04015 Rap1 signaling pathway
    100460498 (FGF18)
   04020 Calcium signaling pathway
    100460498 (FGF18)
   04151 PI3K-Akt signaling pathway
    100460498 (FGF18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460498 (FGF18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460498 (FGF18)
  09162 Cancer: specific types
   05226 Gastric cancer
    100460498 (FGF18)
   05218 Melanoma
    100460498 (FGF18)
   05224 Breast cancer
    100460498 (FGF18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100460498 (FGF18)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100460498 (FGF18)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100460498 (FGF18)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100460498 (FGF18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100460498
NCBI-ProteinID: XP_002816235
Ensembl: ENSPPYG00000016038
UniProt: H2PHC7 A0A663D7J4
LinkDB
Position
5
AA seq 207 aa
MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQPELQKPFKYTTVTKRSRRIRPTHPA
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtattcagcgccctccgcctgcacttgcctgtgtttacacttcctgctgctgtgcttc
caggtacaggtgctggttgccgaggagaacgtggacttccgcatccacgtggagaaccag
acgcgggctcgggacgatgtgagccgtaagcagctgcggctgtaccagctctacagccgg
accagtgggaaacacatccaggtcctgggccgcaggatcagtgcccgcggcgaggatggg
gacaagtatgcccagctcctagtggagacagacaccttcggtagtcaagtccggatcaag
ggcaaggagacggaattctacctgtgcatgaaccgcaaaggcaagctcgtggggaagccc
gatggcaccagcaaggagtgtgtgttcatcgagaaggttctggagaacaactacacggcc
ctgatgtcggctaagtactccggctggtacgtgggcttcaccaagaaggggcggccgcgg
aagggccccaagacccgggagaaccagcaggacgtgcatttcatgaagcgctaccccaag
gggcagccggagcttcagaagcccttcaagtacacgacggtgaccaagaggtcccgtcgg
atccggcccacacaccccgcctag

KEGG   Pongo abelii (Sumatran orangutan): 100460891
Entry
100460891         CDS       T01416                                 

Gene name
FGF20
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100460891 (FGF20)
   04014 Ras signaling pathway
    100460891 (FGF20)
   04015 Rap1 signaling pathway
    100460891 (FGF20)
   04020 Calcium signaling pathway
    100460891 (FGF20)
   04151 PI3K-Akt signaling pathway
    100460891 (FGF20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460891 (FGF20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460891 (FGF20)
  09162 Cancer: specific types
   05226 Gastric cancer
    100460891 (FGF20)
   05218 Melanoma
    100460891 (FGF20)
   05224 Breast cancer
    100460891 (FGF20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100460891 (FGF20)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100460891 (FGF20)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100460891 (FGF20)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100460891 (FGF20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100460891
NCBI-ProteinID: XP_002818879
Ensembl: ENSPPYG00000018382
UniProt: A0A6D2VSU8 A0A2J8X3S9
LinkDB
Position
8
AA seq 211 aa
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGAAERSARGGPGAAELAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcccttagccgaagtcgggggctttctgggcggcctagagggcttgggccagcag
gtgggttcgcatttcctgttgcctcctgccggggagcggccgccgctgctgggcgagcgc
aggggcgcggcggagcggagcgcccgcggcgggccgggggctgcggagctggcgcacctg
cacggcatcctgcgccgccggcagctctattgccgcaccggcttccacctgcagatcctg
cccgacggcagcgtgcagggcacccggcaggaccacagcctcttcggtatcttggaattc
atcagtgtggcagtgggactggtcagtattagaggtgtggacagtggtctctatcttgga
atgaatgacaaaggagaactctatggatcagagaaacttacttccgaatgcatctttagg
gagcagtttgaagagaactggtataacacctattcatctaacatatataaacatggagac
actggccgcaggtattttgtggcacttaacaaagacggaactccaagagatggcgccagg
tccaaaaggcatcagaaatttacacatttcttacctagaccagtggatccagaaagagtt
ccagaattgtacaaggacctactgatgtacacttga

DBGET integrated database retrieval system